| 1 | sequence | id | name | partnerprotein | partnerprotein_textbox | target_order | target_species | activity | taxonid | lc50 | units | non_toxic | percentage_mortality | publication | other_citations | life_stage | instar | assay_material | assay_method | comment | data_entered_by | date |
|---|
| 2 | | 47612 | 261sip01 | No | Not applicable | Coleoptera | Holotrichia parallela | Yes | 93412 | 18.5 | µg/g | | | | CN106905420B | larvae | | | | | Victoria Valby | 2024-09-18 |
| 3 | | 47614 | 261sip02 | No | Not applicable | Coleoptera | Holotrichia parallela | Yes | 93412 | 26.4 | µg/g | | | | CN107022009B | larvae | | | | | Victoria Valby | 2024-09-20 |
| 4 | | 131437 | 5618-Cry1Ia | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20130254933A1 | larvae | | | | No LC50 or percentage mortality was given but it was stated that the protein was active against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 5 | | 131438 | 5618-Cry1Ia | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | | US20130254933A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given but it was stated that the protein was active against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 6 | | 131439 | 5621-Cry1Ia | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20130254933A1 | larvae | | | | No LC50 or percentage mortality was given but it was stated that the protein was active against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 7 | | 131440 | 5621-Cry1Ia | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | | US20130254933A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given but it was stated that the protein was active against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 8 | | 47845 | APG00002 | No | Not applicable | Hemiptera | Euschistus servus | Yes | 756488 | | | | | | WO2016168289A1 | larvae | 1st Instar | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was "some" mortality observed at 50 ppm. | Victoria Valby | 2024-09-05 |
| 9 | | 131442 | APG00003 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 10 | | 131441 | APG00003 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 11 | | 131443 | APG00003 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 12 | | 131066 | APG00003 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 13 | | 131444 | APG00006 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting and mortality observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 14 | | 131067 | APG00006 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 15 | | 47675 | APG00008 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | greater than 80% at 500 µl | | KR20170101247A | larvae | 1st Instar | | Diet incorporation | It was stated that 125 ul of the sonicated lysate was added to the diet surface | Victoria Valby | 2024-11-20 |
| 16 | | 131445 | APG00008 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | WO2016106066A3 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 17 | | 131068 | APG00008 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | >80% at 60 µl | | WO2016106066A3 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 18 | | 131446 | APG00008 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016106066A3 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 19 | | 47676 | APG00010 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | greater than 80% at 125 µl | | KR20170101247A | larvae | 1st Instar | | Diet incorporation | It was stated that 125 ul of the sonicated lysate was added to the diet surface | Victoria Valby | 2024-11-21 |
| 20 | | 131069 | APG00010 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | >80% at 60 µl | | WO2016106066A3 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 21 | | 131447 | APG00014 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 22 | | 131070 | APG00014 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 23 | | 131449 | APG00016 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 24 | | 131071 | APG00016 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 25 | | 131448 | APG00016 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 26 | | 131072 | APG00024 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 27 | | 131450 | APG00024 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 28 | | 131073 | APG00025 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-60% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 29 | | 131452 | APG00026 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 30 | | 131451 | APG00026 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 31 | | 131074 | APG00028 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-60% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 32 | | 131453 | APG00029 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 33 | | 131075 | APG00029 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 60-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 34 | | 131454 | APG00030 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 35 | | 131455 | APG00032 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 36 | | 131332 | APG00034 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 25% mortality | | US20200318133A1 | | 2nd instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 37 | | 131076 | APG00034 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | >80% at 60 µl | | WO2016106066A3 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 38 | | 47677 | APG00034 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | greater than 80% at 125 µl | | KR20170101247A | larvae | 1st Instar | | Diet incorporation | It was stated that 125 ul of the sonicated lysate was added to the diet surface | Victoria Valby | 2024-11-22 |
| 39 | | 131077 | APG00035 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 40 | | 131456 | APG00039 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | WO2016106066A3 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 41 | | 47678 | APG00039 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | KR20170101247A | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was "some growth inhibition" observed. | Victoria Valby | 2024-11-23 |
| 42 | | 131459 | APG00040 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 43 | | 131457 | APG00040 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 44 | | 131078 | APG00040 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 45 | | 131458 | APG00040 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 46 | | 131460 | APG00042 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 47 | | 47846 | APG00046 | No | Not applicable | Hemiptera | Euschistus servus | Yes | 756488 | | | | | | WO2016168289A1 | larvae | 1st Instar | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was "some" mortality observed at >500 ppm. | Victoria Valby | 2024-10-05 |
| 48 | | 131079 | APG00047 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 49 | | 131461 | APG00047 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 50 | | 131080 | APG00049 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 51 | | 131462 | APG00049 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 52 | | 131081 | APG00050 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 53 | | 131464 | APG00052 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016106066A3 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting and low feeding observed against/regarding the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 54 | | 47679 | APG00052 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 500 µl | | KR20170101247A | larvae | 1st Instar | | Diet incorporation | It was stated that 125 ul of the sonicated lysate was added to the diet surface | Victoria Valby | 2024-11-24 |
| 55 | | 131463 | APG00052 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | WO2016106066A3 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 56 | | 131082 | APG00052 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | WO2016106066A3 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 57 | | 131467 | APG00055 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 58 | | 131465 | APG00055 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 59 | | 131466 | APG00055 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 60 | | 131083 | APG00055 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 61 | | 47559 | APG00056 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-07-27 |
| 62 | | 131084 | APG00056 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 6 µl | | MX2017013062A | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 63 | | 47847 | APG00059 | No | Not applicable | Hemiptera | Euschistus servus | Yes | 756488 | | | | | | WO2016168289A1 | larvae | 1st Instar | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was "some" mortality observed at <10ppm | Victoria Valby | 2024-11-05 |
| 64 | | 131468 | APG00061 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 65 | | 131469 | APG00065 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | WO2016106066A3 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 66 | | 47680 | APG00065 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | KR20170101247A | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was "some growth inhibition" observed. | Victoria Valby | 2024-11-25 |
| 67 | | 131470 | APG00073 | No | Not applicable | Lepidoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 68 | | 131471 | APG00073 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | AU2016252027A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting of the indicated insect species observed at 125 µl | Victoria Valby | 2023-12-18 |
| 69 | | 47560 | APG00073 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-07-28 |
| 70 | | 131085 | APG00076 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | WO2016106066A3 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 71 | | 47681 | APG00076 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 125 µl | | KR20170101247A | larvae | 1st Instar | | Diet incorporation | It was stated that 125 ul of the sonicated lysate was added to the diet surface | Victoria Valby | 2024-11-26 |
| 72 | | 131086 | APG00078 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | AU2021202218A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 73 | | 131333 | APG00078 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 25% mortality | | AU2021202218A1 | larvae | 2nd instar | | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 74 | | 131472 | APG00078 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | AU2021202218A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 75 | | 47684 | APG00078 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | KR20180019668A | larvae | | | Diet incorporation | It was stated that there was "insecticidal activity" observed when 125 ?l of protein lysate was added to diet surface. | Victoria Valby | 2024-11-29 |
| 76 | | 131473 | APG00083 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 77 | | 131474 | APG00084 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | AU2016252027A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was simple stunting against the indicated insect species observed at 125 µl | Victoria Valby | 2023-12-18 |
| 78 | | 47561 | APG00084 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-07-29 |
| 79 | | 131475 | APG00098 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 80 | | 131476 | APG00102 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 81 | | 131087 | APG00103 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | | | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 82 | | 131477 | APG00106 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 83 | | 131089 | APG00106 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 84 | | 131088 | APG00106 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 85 | | 131090 | APG00108 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 60-100% at 60 µl | | AU2016252027A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 86 | | 47562 | APG00108 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 60-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-07-30 |
| 87 | | 131091 | APG00111 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 88 | | 131092 | APG00116 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 89 | | 47563 | APG00116 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-07-31 |
| 90 | | 131478 | APG00116 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 91 | | 47564 | APG00121 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-01-08 |
| 92 | | 131094 | APG00123 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 93 | | 131093 | APG00123 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 94 | | 131479 | APG00124 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | WO2016106066A3 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 95 | | 47682 | APG00124 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | KR20170101247A | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was "growth inhibition" observed. | Victoria Valby | 2024-11-27 |
| 96 | | 131480 | APG00125 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 97 | | 131095 | APG00127 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 98 | | 131096 | APG00128 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 99 | | 131481 | APG00129 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 100 | | 131097 | APG00130 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | >80% at 60 µl | | WO2016106066A3 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 101 | | 47683 | APG00130 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | greater than 80% at 500 µl | | KR20170101247A | larvae | 1st Instar | | Diet incorporation | It was stated that 125 ul of the sonicated lysate was added to the diet surface | Victoria Valby | 2024-11-28 |
| 102 | | 131098 | APG00134 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 60-100% at 60 µl | | AU2016252027A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 103 | | 47565 | APG00134 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 60-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-02-08 |
| 104 | | 131099 | APG00142 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 105 | | 131484 | APG00142 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 106 | | 131483 | APG00142 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 107 | | 131482 | APG00142 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 108 | | 131100 | APG00146 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 109 | | 131101 | APG00149 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 110 | | 131102 | APG00152 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% mortality | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 111 | | 47566 | APG00152 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-03-08 |
| 112 | | 131485 | APG00152 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 113 | | 131103 | APG00156 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 114 | | 47567 | APG00164 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-04-08 |
| 115 | | 131486 | APG00167 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20160304898A1 | | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 116 | | 131104 | APG00167 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 60-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 117 | | 131105 | APG00169 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 118 | | 131106 | APG00170 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 119 | | 131107 | APG00171 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 120 | | 131108 | APG00174 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 121 | | 131487 | APG00175 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | AU2016252027A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting of the indicated insect species observed at 125 µl | Victoria Valby | 2023-12-18 |
| 122 | | 47568 | APG00175 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the "protein construct" was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-05-08 |
| 123 | | 131109 | APG00176 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 124 | | 47569 | APG00176 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-06-08 |
| 125 | | 131110 | APG00177 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 60-100% mortality | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 126 | | 47570 | APG00177 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 60-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-07-08 |
| 127 | | 131488 | APG00177 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 128 | | 47571 | APG00186 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-08 |
| 129 | | 131111 | APG00193 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 130 | | 47572 | APG00194 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-09-08 |
| 131 | | 131112 | APG00194 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 132 | | 47573 | APG00200 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was pesticidal activity observed. | Victoria Valby | 2024-10-08 |
| 133 | | 131113 | APG00206 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 134 | | 131489 | APG00210 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 135 | | 47574 | APG00210 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-11-08 |
| 136 | | 131114 | APG00210 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 137 | | 131115 | APG00222 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | US20160304898A1 | larvae | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 138 | | 131116 | APG00224 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 139 | | 47575 | APG00227 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-12-08 |
| 140 | | 131117 | APG00239 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 141 | | 131490 | APG00239 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 142 | | 47576 | APG00239 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-13 |
| 143 | | 47577 | APG00248 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was pesitcidal activity observed. | Victoria Valby | 2024-08-14 |
| 144 | | 47578 | APG00267 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-15 |
| 145 | | 47579 | APG00273 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was slight stunting observed. | Victoria Valby | 2024-08-16 |
| 146 | | 47580 | APG00290 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-17 |
| 147 | | 131492 | APG00290 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 148 | | 131491 | APG00290 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 149 | | 131118 | APG00290 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 150 | | 47581 | APG00291 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-18 |
| 151 | | 131119 | APG00291 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% mortality | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 152 | | 131493 | APG00291 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 153 | | 47582 | APG00297 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-19 |
| 154 | | 131494 | APG00297 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 155 | | 131120 | APG00297 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% mortality | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 156 | | 131121 | APG00309 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 157 | | 47615 | APG00309 | No | Not applicable | Hemiptera | Chinavia hilaris | Yes | 244443 | | | | 25% mortality | | CN108271390A | larvae | | | Diet incorporation | No specific concentration provided for observed mortality %. | Victoria Valby | 2024-09-21 |
| 158 | | 131122 | APG00330 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 159 | | 47616 | APG00330 | No | Not applicable | Hemiptera | Chinavia hilaris | Yes | 244443 | | | | 25% mortality | | CN108271390A | larvae | | | Diet incorporation | No specific concentration provided for observed mortality %. | Victoria Valby | 2024-09-22 |
| 160 | | 131495 | APG00330 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20210054403A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 161 | | 131123 | APG00341 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 162 | | 131124 | APG00342 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 163 | | 47583 | APG00342 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-20 |
| 164 | | 131125 | APG00359 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 165 | | 131126 | APG00390 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 166 | | 131127 | APG00410 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 167 | | 131128 | APG00420 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 168 | | 131129 | APG00422 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | AU2016252027A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity against the indicated insect species observed | Victoria Valby | 2023-12-18 |
| 169 | | 131496 | APG00422 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | WO2016171999A2 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 170 | | 47584 | APG00422 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the "protein construct" was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-21 |
| 171 | | 131130 | APG00453 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 172 | | 131131 | APG00455 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 173 | | 47585 | APG00456 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-22 |
| 174 | | 131132 | APG00462 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | AU2016252027A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity against the indicated insect species observed | Victoria Valby | 2023-12-18 |
| 175 | | 47586 | APG00462 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the "protein construct" was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-23 |
| 176 | | 131133 | APG00477 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 177 | | 47617 | APG00488 | No | Not applicable | Hemiptera | Chinavia hilaris | Yes | 244443 | | | | 25% mortality | | CN108271390A | larvae | | | Diet incorporation | No specific concentration provided for observed mortality %. | Victoria Valby | 2024-09-23 |
| 178 | | 131134 | APG00488 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 179 | | 47587 | APG00500 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 60-100% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-24 |
| 180 | | 131135 | APG00522 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 181 | | 131136 | APG00542 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 50-80% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 182 | | 47618 | APG00542 | No | Not applicable | Hemiptera | Chinavia hilaris | Yes | 244443 | | | | 25% mortality | | CN108271390A | larvae | | | Diet incorporation | No specific concentration provided for observed mortality %. | Victoria Valby | 2024-09-24 |
| 183 | | 131334 | APG00556.1 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 100% mortality | | US11118190B2 | | 2nd instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 184 | | 131137 | APG00556.1 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% mortality | | US11118190B2 | | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 185 | | 131138 | APG00562 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 186 | | 131497 | APG00589.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 187 | | 131498 | APG00589.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 188 | | 131139 | APG00598 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 189 | | 131335 | APG00623.0 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 100% mortality | | US11118190B2 | | 2nd instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 190 | | 131140 | APG00623.0 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% mortality | | US11118190B2 | | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 191 | | 47588 | APG00647 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was "some" mortality and slight stunting observed. | Victoria Valby | 2024-08-25 |
| 192 | | 47589 | APG00698 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was "some" mortality and slight stunting observed. | Victoria Valby | 2024-08-26 |
| 193 | | 131141 | APG00719 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 194 | | 131499 | APG00738.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 195 | | 131501 | APG00743.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 196 | | 131500 | APG00743.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 197 | | 131142 | APG00755 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 80-100% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 198 | | 131143 | APG00780 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 199 | | 131503 | APG00799 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | AU2016252027A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting of the indicated insect species observed at 125 µl | Victoria Valby | 2023-12-18 |
| 200 | | 131502 | APG00799 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | AU2016252027A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting of the indicated insect species observed at 125 µl | Victoria Valby | 2023-12-18 |
| 201 | | 47590 | APG00801 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | AU2016252027B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 60 ul of the protein construct was added onto the surface of diet, with a total of 500 ul of diet in each of 24 wells. | Victoria Valby | 2024-08-27 |
| 202 | | 131504 | APG00808.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 203 | | 131509 | APG00926.0 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 204 | | 131144 | APG00926.0 | No | Not applicable | Coleoptera | Diabrotica undecimpunctata howardi | Yes | 50388 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there may have been some pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 205 | | 131505 | APG00926.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 206 | | 131506 | APG00926.0 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 207 | | 131507 | APG00926.0 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 208 | | 131508 | APG00926.0 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 209 | | 131510 | APG00926.0 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there may have been some pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 210 | | 131511 | APG00926.0 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 211 | | 131512 | APG00926.0 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 212 | | 131513 | APG00926.0 | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there may have been some pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 213 | | 131514 | APG00926.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 214 | | 131145 | APG00926.0 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there may have been some pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 215 | | 131515 | APG00945.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 216 | | 131516 | APG00989.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 217 | | 131146 | APG00994 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 0-50% at 60 µl | | US20210054403A1 | larvae | 1st instar | | diet incorporation | | Victoria Valby | 2023-12-18 |
| 218 | | 47619 | APG00994 | No | Not applicable | Hemiptera | Chinavia hilaris | Yes | 244443 | | | | 25% mortality | | CN108271390A | larvae | | | Diet incorporation | No specific concentration provided for observed mortality %. | Victoria Valby | 2024-09-25 |
| 219 | | 131148 | APG00998.2 | No | Not applicable | Coleoptera | Diabrotica undecimpunctata howardi | Yes | 50388 | | | | 70% at 60 µl | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 220 | | 131149 | APG00998.2 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% at 60 µl | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 221 | | 131517 | APG00998.2 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 222 | | 131147 | APG00998.2 | No | Not applicable | Coleoptera | Diabrotica barberi | Yes | 50386 | | | | 100% at 60 µl | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 223 | | 47620 | APG01037.1 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% mortality | | CN109312354A | larvae | 1st Instar | | Diet incorporation | It was stated that 500 ul of the diet was used and the amount of protein construct/lysate was assessed in measurement | Victoria Valby | 2024-09-26 |
| 224 | | 131336 | APG01037.1 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 100% mortality | | US11118190B2 | | 2nd instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 225 | | 131150 | APG01037.1 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% mortality | | US11118190B2 | | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 226 | | 131151 | APG01037.4 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% mortality | | US11118190B2 | | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 227 | | 131337 | APG01037.4 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 100% mortality | | US11118190B2 | | 2nd instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 228 | | 131152 | APG01037.5 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% mortality | | US11118190B2 | | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 229 | | 131338 | APG01037.5 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 100% mortality | | US11118190B2 | | 2nd instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 230 | | 131518 | APG01037.5 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | 100% at 315 µg/cm2 | | US11118190B2 | | | Purified protein | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 231 | | 131339 | APG01037.6 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 100% mortality | | US11118190B2 | | 2nd instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 232 | | 131153 | APG01037.6 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% mortality | | US11118190B2 | | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 233 | | 131340 | APG01037.7 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 100% mortality | | US11118190B2 | | 2nd instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 234 | | 131154 | APG01037.7 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% mortality | | US11118190B2 | | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 235 | | 131341 | APG01037.8 | No | Not applicable | Hemiptera | Nezara viridula | Yes | 85310 | | | | 100% mortality | | US11118190B2 | | 2nd instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 236 | | 131155 | APG01037.8 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% mortality | | US11118190B2 | | 1st instar | Purified protein | Diet incorporation | No concentration of protein was given for observed mortality | Victoria Valby | 2023-12-18 |
| 237 | | 131519 | APG01084.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 238 | | 131520 | APG01084.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 ul. | Victoria Valby | 2023-12-18 |
| 239 | | 131521 | APG01150.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 240 | | 131522 | APG01199.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting and mortality observed against the indicated insect species at 125 µl | Victoria Valby | 2023-12-18 |
| 241 | | 131523 | APG01269.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 242 | | 131524 | APG01420.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 243 | | 131525 | APG01463.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 244 | | 131156 | APG01463.0 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 245 | | 131527 | APG01700.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 246 | | 131526 | APG01700.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 247 | | 131528 | APG01705.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 248 | | 131530 | APG01989.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 249 | | 131529 | APG01989.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 250 | | 131531 | APG01992.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 251 | | 131157 | APG01992.1 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 252 | | 131158 | APG02067.2 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 253 | | 131532 | APG02067.2 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 254 | | 131533 | APG02245.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 255 | | 131534 | APG02245.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 256 | | 131536 | APG02387.2 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 257 | | 131535 | APG02387.2 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 258 | | 131537 | APG02429.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 259 | | 131538 | APG02429.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 260 | | 131539 | APG02557.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 261 | | 131540 | APG02557.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 262 | | 131541 | APG02633.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 263 | | 131542 | APG02740.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 264 | | 131543 | APG02768.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 265 | | 131544 | APG02768.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 266 | | 131159 | APG02923.0 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 267 | | 131546 | APG03040.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 268 | | 131545 | APG03040.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 ul. | Victoria Valby | 2023-12-18 |
| 269 | | 131547 | APG03185.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 270 | | 131549 | APG03185.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 271 | | 131548 | APG03185.1 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 272 | | 131550 | APG03217.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 273 | | 131551 | APG03217.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 274 | | 131552 | APG03368.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 275 | | 131553 | APG03440.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 276 | | 131554 | APG03440.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 277 | | 131555 | APG03484.2 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 278 | | 131557 | APG03686.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 279 | | 131556 | APG03686.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 280 | | 131558 | APG03715.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125µl. | Victoria Valby | 2023-12-18 |
| 281 | | 131559 | APG03760.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was some mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 282 | | 131161 | APG03760.0 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 283 | | 131160 | APG03760.0 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | US20200392532A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species at 60 µl. | Victoria Valby | 2023-12-18 |
| 284 | | 131561 | APG03760.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was some mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 285 | | 131560 | APG03760.0 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was some mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 286 | | 131563 | APG03831.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 287 | | 131562 | APG03831.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 288 | | 131162 | APG04067.0 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 289 | | 131564 | APG04067.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 290 | | 131565 | APG04226.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 291 | | 131567 | APG04446.0 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 292 | | 131566 | APG04446.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 293 | | 131572 | APG04446.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 294 | | 131571 | APG04446.0 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 295 | | 131570 | APG04446.0 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 296 | | 131569 | APG04446.0 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was some mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 297 | | 131568 | APG04446.0 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 298 | | 131573 | APG04450.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 299 | | 131574 | APG04483.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 300 | | 131576 | APG04643.2 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 301 | | 131575 | APG04643.2 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 302 | | 131577 | APG04686.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species 125 µl. | Victoria Valby | 2023-12-18 |
| 303 | | 131578 | APG04721.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 304 | | 131579 | APG04721.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 305 | | 131580 | APG04778.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 306 | | 131163 | APG04778.0 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 307 | | 131582 | APG04793.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 308 | | 131581 | APG04793.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 309 | | 131584 | APG05213.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 310 | | 131583 | APG05213.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 311 | | 131588 | APG05322.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 312 | | 131587 | APG05322.1 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 313 | | 131585 | APG05322.1 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was some mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 314 | | 131586 | APG05322.1 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 315 | | 131594 | APG05322.2 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 316 | | 131592 | APG05322.2 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 317 | | 131591 | APG05322.2 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 318 | | 131590 | APG05322.2 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 319 | | 131589 | APG05322.2 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 320 | | 131595 | APG05322.2 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was high mortality and strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 321 | | 131593 | APG05322.2 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | CA3214227A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was strong stunting observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 322 | | 131596 | APG05500.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 323 | | 131597 | APG05553.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 324 | | 131598 | APG05634.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125µl. | Victoria Valby | 2023-12-18 |
| 325 | | 131599 | APG05660.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 326 | | 131600 | APG05660.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 327 | | 131164 | APG05706.1 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 328 | | 131601 | APG05969.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was some mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 329 | | 131602 | APG06001.1 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 330 | | 131603 | APG06001.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 331 | | 131604 | APG06338.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 332 | | 131165 | APG06384.0 | No | Not applicable | Coleoptera | Diabrotica barberi | Yes | 50386 | | | | 100% at 60 µl | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 333 | | 131166 | APG06384.0 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% at 60 µl | | CA3214227A1 | larvae | 1st instar | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 334 | | 131605 | APG06465.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 335 | | 131606 | APG06501.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 336 | | 131167 | APG06501.0 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 337 | | 131607 | APG06589.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 338 | | 131608 | APG06894.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 339 | | 131609 | APG06997.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 340 | | 131610 | APG07049.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 341 | | 131168 | APG07114.0 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 342 | | 131612 | APG07470.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 343 | | 131611 | APG07470.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 344 | | 131613 | APG07639.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 345 | | 131616 | APG07676.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 346 | | 131615 | APG07676.1 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 347 | | 131614 | APG07676.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 348 | | 131169 | APG07682.0 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 349 | | 131618 | APG08085.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 350 | | 131617 | APG08085.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 351 | | 131619 | APG08138.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 352 | | 131621 | APG08151.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 353 | | 131620 | APG08151.1 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 354 | | 131622 | APG08241.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 355 | | 131170 | APG08241.0 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | US20200392532A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species at 60 µl. | Victoria Valby | 2023-12-18 |
| 356 | | 131172 | APG08509.1 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 357 | | 131623 | APG08509.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 358 | | 131625 | APG08509.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 359 | | 131624 | APG08509.1 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 360 | | 131171 | APG08509.1 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | US20200392532A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species at 60 µl. | Victoria Valby | 2023-12-18 |
| 361 | | 131626 | APG08607.2 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 362 | | 131627 | APG08607.2 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was slight stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 363 | | 131628 | APG08628.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 364 | | 131630 | APG08718.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 365 | | 131629 | APG08718.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 366 | | 131173 | APG08794.0 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | | | US20200392532A1 | larvae | 1st instar | | Leaf-disks | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 367 | | 131632 | APG08990.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 368 | | 131631 | APG08990.1 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 369 | | 131633 | APG09055.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 370 | | 131634 | APG09096.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 371 | | 131635 | APG09455.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 372 | | 131636 | APG09735.1 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 373 | | 131638 | APG09842.0 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality and stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 374 | | 131637 | APG09842.0 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200392532A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species at 125 µl. | Victoria Valby | 2023-12-18 |
| 375 | | 131176 | APG57124.0 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 376 | | 131174 | APG57124.0 | No | Not applicable | Coleoptera | Diabrotica barberi | Yes | 50386 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 377 | | 131175 | APG57124.0 | No | Not applicable | Coleoptera | Diabrotica undecimpunctata howardi | Yes | 50388 | | | | | | WO2023107943A1 | larvae | 1st instar | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was pesticidal activity observed against the indicated insect species. | Victoria Valby | 2023-12-18 |
| 378 | | 47790 | AfIP-1A-31 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | 1.151 | ppm | | | | US20170006867A1_x000D_ | larvae | 1st Instar | Purified protein | Diet incorporation | | Victoria Valby | 2024-03-15 |
| 379 | | 47791 | AfIP-1B-32 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | 1.158 | ppm | | | | US20170006867A1 | larvae | 1st Instar | Purified protein | Diet incorporation | | Victoria Valby | 2024-03-16 |
| 380 | | 46779 | AflP-1A | Yes | AflP-1B | Lepidoptera | Helicoverpa zea | No | 7113 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-06 |
| 381 | | 46777 | AflP-1A | Yes | AflP-1B | Coleoptera | Diabrotica undecimpunctata | Yes | 50387 | 11.2 | ppm | | | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Diet incorporation | | Colin Berry | 2024-05-06 |
| 382 | | 46778 | AflP-1A | Yes | AflP-1B | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | 30.4 | ppm | | | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Diet incorporation | | Colin Berry | 2024-06-06 |
| 383 | | 46772 | AflP-1A | Yes | AflP-1B | Lepidoptera | Agrotis ipsilon | No | 56364 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2024-05-31 |
| 384 | | 46770 | AflP-1A | Yes | AflP-1B | Lepidoptera | Spodoptera frugiperda | No | 7108 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified_protein | Surface contamination | | Colin Berry | 2024-05-29 |
| 385 | | 46780 | AflP-1A | Yes | AflP-1B | Lepidoptera | Ostrinia nubilalis | No | 29057 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2024-08-06 |
| 386 | | 46773 | AflP-1A | Yes | AflP-1B | Lepidoptera | Anticarsia gemmatalis | No | 129554 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | Stunting when used in combination at 125ppm | Colin Berry | 2024-01-06 |
| 387 | | 46775 | AflP-1A | Yes | AflP-1B | Coleoptera | Coleomegilla maculata | No | 279632 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Not specified | | Colin Berry | 2024-03-06 |
| 388 | | 46776 | AflP-1A | Yes | AflP-1B | Coleoptera | Diabrotica barberi | Yes | 50386 | greater than 240 | ppm | | 12.5% mortality | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Diet incorporation | 12.5% mortality at 240ppm | Colin Berry | 2024-04-06 |
| 389 | | 46774 | AflP-1A | Yes | AflP-1B | Lepidoptera | Chrysodeixis includens | No | 689277 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | Stunting when used in combination at 125ppm | Colin Berry | 2024-02-06 |
| 390 | | 46782 | AflP-1B | Yes | AflP-1A | Lepidoptera | Anticarsia gemmatalis | No | 129554 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | Stunting when used in combination at 125ppm | Colin Berry | 2024-10-06 |
| 391 | | 46783 | AflP-1B | Yes | AflP-1A | Lepidoptera | Chrysodeixis includens | No | 689277 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | Stunting when used in combination at 125ppm | Colin Berry | 2024-11-06 |
| 392 | | 46788 | AflP-1B | Yes | AflP-1A | Lepidoptera | Helicoverpa zea | No | 7113 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2024-06-16 |
| 393 | | 46786 | AflP-1B | Yes | AflP-1A | Coleoptera | Diabrotica undecimpunctata | Yes | 50387 | 11.2 | ppm | | | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Diet incorporation | | Colin Berry | 2024-06-14 |
| 394 | | 46785 | AflP-1B | Yes | AflP-1A | Coleoptera | Diabrotica barberi | Yes | 50386 | greater than 240 | ppm | | 12.5% mortality | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Diet incorporation | 12.5% mortality at 240ppm | Colin Berry | 2024-06-13 |
| 395 | | 46787 | AflP-1B | Yes | AflP-1A | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | 30.4 | ppm | | | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Diet incorporation | | Colin Berry | 2024-06-15 |
| 396 | | 46771 | AflP-1B | Yes | AflP-1A | Lepidoptera | Spodoptera frugiperda | No | 7108 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified_protein | Surface contamination | | Colin Berry | 2024-05-30 |
| 397 | | 46789 | AflP-1B | Yes | AflP-1A | Lepidoptera | Ostrinia nubilalis | No | 29057 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2024-06-17 |
| 398 | | 46784 | AflP-1B | Yes | AflP-1A | Coleoptera | Coleomegilla maculata | No | 279632 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Not specified | | Colin Berry | 2024-12-06 |
| 399 | | 46781 | AflP-1B | Yes | AflP-1A | Lepidoptera | Agrotis ipsilon | No | 56364 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-03544-9 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2024-09-06 |
| 400 | MDNNMLLNQSLEENKLPNSEVPAATLNILTGQVQGAARSAGIFT
KEDLINIKLYVKNGLELPFTLPTVKEYIHYNDTNIEGLKPENIKTLFEEIHNHALSWS
KVEDKVQQQSIDLENAGKQITQKGESIIKIIEKMPITDSIETLKNTYNNRKPTNEQLF
KITYTDVDKKVAVGLKSILESMEKDVKGYRENSQQVKDAITDFKITLFGGTLSDGKTA
DGLLPQVDTKKKLMDDNNLSTTVKELQDEINEKKRDIEQLQKDYDQYVKLSLSGAISV
IGVVITGSIFGPKAENARKQKNELIEKVKELQEQIKGASALQTALQNLSLHFLNIRSC
MQDAEVALKHLDVMWSTMLEQINLSKKSFAEIDNASMLLMFEETFKQAISPWKEVQGS AEKLVKIFDEALAEYKKRSK
| 138881 | App1Da1 | Yes | App2Ca1 | Lepidoptera | Helicoverpa armigera | No | 29058 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1111/1574-6968.12321 | | Larvae | 1st instar | Purified protein | Surface contamination | No oral toxicity, injection toxicity not assessed | Colin Berry | 2025-09-04 |
| 401 | MDNNMLLNQSLEENKLPNSEVPAATLNILTGQVQGAARSAGIFT
KEDLINIKLYVKNGLELPFTLPTVKEYIHYNDTNIEGLKPENIKTLFEEIHNHALSWS
KVEDKVQQQSIDLENAGKQITQKGESIIKIIEKMPITDSIETLKNTYNNRKPTNEQLF
KITYTDVDKKVAVGLKSILESMEKDVKGYRENSQQVKDAITDFKITLFGGTLSDGKTA
DGLLPQVDTKKKLMDDNNLSTTVKELQDEINEKKRDIEQLQKDYDQYVKLSLSGAISV
IGVVITGSIFGPKAENARKQKNELIEKVKELQEQIKGASALQTALQNLSLHFLNIRSC
MQDAEVALKHLDVMWSTMLEQINLSKKSFAEIDNASMLLMFEETFKQAISPWKEVQGS AEKLVKIFDEALAEYKKRSK
| 138882 | App1Da1 | Yes | App2Ca1 | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | | | | >90% | 10.1111/1574-6968.12321 | | Cultured cells | | Purified protein | Addition to cultured cells | CF-203 cells used. No activity for individual components alone | Colin Berry | 2025-09-04 |
| 402 | MDNNMLLNQSLEENKLPNSEVPAATLNILTGQVQGAARSAGIFT
KEDLINIKLYVKNGLELPFTLPTVKEYIHYNDTNIEGLKPENIKTLFEEIHNHALSWS
KVEDKVQQQSIDLENAGKQITQKGESIIKIIEKMPITDSIETLKNTYNNRKPTNEQLF
KITYTDVDKKVAVGLKSILESMEKDVKGYRENSQQVKDAITDFKITLFGGTLSDGKTA
DGLLPQVDTKKKLMDDNNLSTTVKELQDEINEKKRDIEQLQKDYDQYVKLSLSGAISV
IGVVITGSIFGPKAENARKQKNELIEKVKELQEQIKGASALQTALQNLSLHFLNIRSC
MQDAEVALKHLDVMWSTMLEQINLSKKSFAEIDNASMLLMFEETFKQAISPWKEVQGS AEKLVKIFDEALAEYKKRSK
| 138880 | App1Da1 | Yes | App2Ca1 | Lepidoptera | Spodoptera exigua | Yes | 7107 | | | | 0.97 | 10.1111/1574-6968.12321 | | Larvae | 4th instar | Purified protein | Injection | No oral toxicity to 1st instars. No toxicity for individual components | Colin Berry | 2025-09-04 |
| 403 | MSESIISQKEIQYPKVNIKSLDETVNKIWLLAKQQTSGITAIAE
KAERVSSYSRELSELVSESLSKLPPILSQFLAGDIFQSIRKIDKALEAHDLSDEKRSD
ILKARDQFIQKLSKDIDNVIANFDDRINKLTGKINDINDIVIAGHFEDVLAKTKKQKA
ELQSDIEQKTKERKKLDAERDKIIESQDVIRAKNIADMFKDYLPNTNDIDGLNFAQPE
KEIIKQSIEIVKKVLGKISEGLKYIDLENARMKLTEQIDHTMQESKALKTTLEETELR
LSGLKDVMQIDTERTTMLNEVGKLEKAWRLFSSQLHELSDKNINQDYLTNLINGQLNF LDNLVISI
| 138885 | App2Ca1 | Yes | App1Da1 | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | | | | >90% | 10.1111/1574-6968.12321 | | Cultured cells | | Purified protein | Addition to cultured cells | CF-203 cells used. No activity for individual components alone | Colin Berry | 2025-09-04 |
| 404 | MSESIISQKEIQYPKVNIKSLDETVNKIWLLAKQQTSGITAIAE
KAERVSSYSRELSELVSESLSKLPPILSQFLAGDIFQSIRKIDKALEAHDLSDEKRSD
ILKARDQFIQKLSKDIDNVIANFDDRINKLTGKINDINDIVIAGHFEDVLAKTKKQKA
ELQSDIEQKTKERKKLDAERDKIIESQDVIRAKNIADMFKDYLPNTNDIDGLNFAQPE
KEIIKQSIEIVKKVLGKISEGLKYIDLENARMKLTEQIDHTMQESKALKTTLEETELR
LSGLKDVMQIDTERTTMLNEVGKLEKAWRLFSSQLHELSDKNINQDYLTNLINGQLNF LDNLVISI
| 138884 | App2Ca1 | Yes | App1Da1 | Lepidoptera | Helicoverpa armigera | No | 29058 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1111/1574-6968.12321 | | Larvae | 1st instar | Purified protein | Surface contamination | No oral toxicity, injection toxicity not assessed | Colin Berry | 2025-09-04 |
| 405 | MSESIISQKEIQYPKVNIKSLDETVNKIWLLAKQQTSGITAIAE
KAERVSSYSRELSELVSESLSKLPPILSQFLAGDIFQSIRKIDKALEAHDLSDEKRSD
ILKARDQFIQKLSKDIDNVIANFDDRINKLTGKINDINDIVIAGHFEDVLAKTKKQKA
ELQSDIEQKTKERKKLDAERDKIIESQDVIRAKNIADMFKDYLPNTNDIDGLNFAQPE
KEIIKQSIEIVKKVLGKISEGLKYIDLENARMKLTEQIDHTMQESKALKTTLEETELR
LSGLKDVMQIDTERTTMLNEVGKLEKAWRLFSSQLHELSDKNINQDYLTNLINGQLNF LDNLVISI
| 138883 | App2Ca1 | Yes | App1Da1 | Lepidoptera | Spodoptera exigua | Yes | 7107 | | | | 0.97 | 10.1111/1574-6968.12321 | | Larvae | 4th instar | Purified protein | Injection | No oral toxicity to 1st instars. No toxicity for individual components | Colin Berry | 2025-09-04 |
| 406 | MMVKRDISPRDLGGKEDSPFLLSKEEWITIQKYTGDGAYVPVNEAEMRKALALSASDEMPDFNELYSVYTNVKNHCQNWT
DNTYREVLGVANEIVNYSRRAKVYYKPLIDYLPAIIDGDTEALEMFKKICERLAREAAEFRDHAGSLATMIGTFATDTAN
DYQSLKVVKDKYDEKYGDHSDEVKQLRASVERLREDLEEYMDEYEDYQSQSWLSLLLGPIFGFVLKGILDSTKGKALKAR
IDATKQQIEESDKIIQRNVYLMSLLDKTDTGTDKIQEQMAAALPIIQKIHGIWNSLHSDLDELSKIVMEDIHDDPEFADL
GVELAIMQWEAVGKQADDFRVNADVGFVVEQYTA
| 47732 | App4Aa1 | No | Not applicable | Lepidoptera | Diatraea grandiosella | No | 61289 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | Purified protein | Diet incorporation | Described as axmi058 in patent | Colin Berry | 2024-01-16 |
| 407 | MMVKRDISPRDLGGKEDSPFLLSKEEWITIQKYTGDGAYVPVNEAEMRKALALSASDEMPDFNELYSVYTNVKNHCQNWT
DNTYREVLGVANEIVNYSRRAKVYYKPLIDYLPAIIDGDTEALEMFKKICERLAREAAEFRDHAGSLATMIGTFATDTAN
DYQSLKVVKDKYDEKYGDHSDEVKQLRASVERLREDLEEYMDEYEDYQSQSWLSLLLGPIFGFVLKGILDSTKGKALKAR
IDATKQQIEESDKIIQRNVYLMSLLDKTDTGTDKIQEQMAAALPIIQKIHGIWNSLHSDLDELSKIVMEDIHDDPEFADL
GVELAIMQWEAVGKQADDFRVNADVGFVVEQYTA
| 47733 | App4Aa1 | No | Not applicable | Lepidoptera | Helicoverpa zea | No | 7113 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | Purified protein | Diet incorporation | Described as axmi058 in patent | Colin Berry | 2024-01-17 |
| 408 | MMVKRDISPRDLGGKEDSPFLLSKEEWITIQKYTGDGAYVPVNEAEMRKALALSASDEMPDFNELYSVYTNVKNHCQNWT
DNTYREVLGVANEIVNYSRRAKVYYKPLIDYLPAIIDGDTEALEMFKKICERLAREAAEFRDHAGSLATMIGTFATDTAN
DYQSLKVVKDKYDEKYGDHSDEVKQLRASVERLREDLEEYMDEYEDYQSQSWLSLLLGPIFGFVLKGILDSTKGKALKAR
IDATKQQIEESDKIIQRNVYLMSLLDKTDTGTDKIQEQMAAALPIIQKIHGIWNSLHSDLDELSKIVMEDIHDDPEFADL
GVELAIMQWEAVGKQADDFRVNADVGFVVEQYTA
| 47734 | App4Aa1 | No | Not applicable | Lepidoptera | Heliothis virescens | No | 7102 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | Purified protein | Diet incorporation | Described as axmi058 in patent | Colin Berry | 2024-01-18 |
| 409 | MMVKRDISPRDLGGKEDSPFLLSKEEWITIQKYTGDGAYVPVNEAEMRKALALSASDEMPDFNELYSVYTNVKNHCQNWT
DNTYREVLGVANEIVNYSRRAKVYYKPLIDYLPAIIDGDTEALEMFKKICERLAREAAEFRDHAGSLATMIGTFATDTAN
DYQSLKVVKDKYDEKYGDHSDEVKQLRASVERLREDLEEYMDEYEDYQSQSWLSLLLGPIFGFVLKGILDSTKGKALKAR
IDATKQQIEESDKIIQRNVYLMSLLDKTDTGTDKIQEQMAAALPIIQKIHGIWNSLHSDLDELSKIVMEDIHDDPEFADL
GVELAIMQWEAVGKQADDFRVNADVGFVVEQYTA
| 47736 | App4Aa1 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | No | 29057 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | Purified protein | Diet incorporation | Described as axmi058 in patent | Colin Berry | 2024-01-20 |
| 410 | MMVKRDISPRDLGGKEDSPFLLSKEEWITIQKYTGDGAYVPVNEAEMRKALALSASDEMPDFNELYSVYTNVKNHCQNWT
DNTYREVLGVANEIVNYSRRAKVYYKPLIDYLPAIIDGDTEALEMFKKICERLAREAAEFRDHAGSLATMIGTFATDTAN
DYQSLKVVKDKYDEKYGDHSDEVKQLRASVERLREDLEEYMDEYEDYQSQSWLSLLLGPIFGFVLKGILDSTKGKALKAR
IDATKQQIEESDKIIQRNVYLMSLLDKTDTGTDKIQEQMAAALPIIQKIHGIWNSLHSDLDELSKIVMEDIHDDPEFADL
GVELAIMQWEAVGKQADDFRVNADVGFVVEQYTA
| 47737 | App4Aa1 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | | US patent 8461421 | | | Purified protein | Diet incorporation | Described as axmi058 in patent | Colin Berry | 2024-01-21 |
| 411 | MMVKRDISPRDLGGKEDSPFLLSKEEWITIQKYTGDGAYVPVNEAEMRKALALSASDEMPDFNELYSVYTNVKNHCQNWT
DNTYREVLGVANEIVNYSRRAKVYYKPLIDYLPAIIDGDTEALEMFKKICERLAREAAEFRDHAGSLATMIGTFATDTAN
DYQSLKVVKDKYDEKYGDHSDEVKQLRASVERLREDLEEYMDEYEDYQSQSWLSLLLGPIFGFVLKGILDSTKGKALKAR
IDATKQQIEESDKIIQRNVYLMSLLDKTDTGTDKIQEQMAAALPIIQKIHGIWNSLHSDLDELSKIVMEDIHDDPEFADL
GVELAIMQWEAVGKQADDFRVNADVGFVVEQYTA
| 47730 | App4Aa1 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | No | 129554 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | Purified protein | Diet incorporation | Described as axmi058 in patent | Colin Berry | 2024-01-14 |
| 412 | MMVKRDISPRDLGGKEDSPFLLSKEEWITIQKYTGDGAYVPVNEAEMRKALALSASDEMPDFNELYSVYTNVKNHCQNWT
DNTYREVLGVANEIVNYSRRAKVYYKPLIDYLPAIIDGDTEALEMFKKICERLAREAAEFRDHAGSLATMIGTFATDTAN
DYQSLKVVKDKYDEKYGDHSDEVKQLRASVERLREDLEEYMDEYEDYQSQSWLSLLLGPIFGFVLKGILDSTKGKALKAR
IDATKQQIEESDKIIQRNVYLMSLLDKTDTGTDKIQEQMAAALPIIQKIHGIWNSLHSDLDELSKIVMEDIHDDPEFADL
GVELAIMQWEAVGKQADDFRVNADVGFVVEQYTA
| 47731 | App4Aa1 | No | Not applicable | Rhabditida | Caenorhabditis elegans | No | 6239 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | Purified protein | Diet incorporation | Described as axmi058 in patent | Colin Berry | 2024-01-15 |
| 413 | MMVKRDISPRDLGGKEDSPFLLSKEEWITIQKYTGDGAYVPVNEAEMRKALALSASDEMPDFNELYSVYTNVKNHCQNWT
DNTYREVLGVANEIVNYSRRAKVYYKPLIDYLPAIIDGDTEALEMFKKICERLAREAAEFRDHAGSLATMIGTFATDTAN
DYQSLKVVKDKYDEKYGDHSDEVKQLRASVERLREDLEEYMDEYEDYQSQSWLSLLLGPIFGFVLKGILDSTKGKALKAR
IDATKQQIEESDKIIQRNVYLMSLLDKTDTGTDKIQEQMAAALPIIQKIHGIWNSLHSDLDELSKIVMEDIHDDPEFADL
GVELAIMQWEAVGKQADDFRVNADVGFVVEQYTA
| 47735 | App4Aa1 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | No | 7539 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | Purified protein | Diet incorporation | Described as axmi058 in patent | Colin Berry | 2024-01-19 |
| 414 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47723 | App6Aa1 | No | Not applicable | Rhabditida | Meloidogyne incognita | Yes | 13164 | | | | | | US 2011/0225681 | | | | | | Colin Berry | 2024-07-01 |
| 415 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 46889 | App6Aa1 | No | Not applicable | Rhabditida | Panagrellus redivivus | Yes | 6233 | | | | | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-25 |
| 416 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 46888 | App6Aa1 | No | Not applicable | Rhabditida | Nippostrongylus brasiliensis | No | 27835 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-24 |
| 417 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47729 | App6Aa1 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | 77 | µg/cm2 | | | | US Patent 5874288 | | | Purified protein | | Trypsin activated form is toxic, unprocessed form is not | Colin Berry | 2024-01-13 |
| 418 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47037 | App6Aa1 | No | Not applicable | Rhabditida | Meloidogyne incognita | Yes | 6302 | | | | | 10.1111/j.1467-7652.2007.00257.x | | | | Transgenic plant | | | Colin Berry | 2024-02-20 |
| 419 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 46887 | App6Aa1 | No | Not applicable | Rhabditida | Distolabrellus veechi | Yes | 96664 | | | | | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-23 |
| 420 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 46886 | App6Aa1 | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | | | | | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-22 |
| 421 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47036 | App6Aa1 | No | Not applicable | Rhabditida | Acrobeloides sp. | Yes | 70201 | | | | | 10.1111/j.1467-7652.2007.00257.x | | | | | | | Colin Berry | 2024-02-19 |
| 422 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 46885 | App6Aa1 | No | Not applicable | Rhabditida | Acrobeloides sp. | Yes | 70201 | | | | | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-21 |
| 423 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47326 | App6Aa1 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 97.5% mortality | 10.1371/journal.pone.0053079 | | | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2024-06-12 |
| 424 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 46890 | App6Aa1 | No | Not applicable | Rhabditida | Pristionchus pacificus | No | 54126 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-26 |
| 425 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47722 | App6Aa1 | No | Not applicable | Rhabditida | Heterodera glycines | Yes | 51029 | | | | | | US 2011/0225681 | | | | | | Colin Berry | 2024-06-01 |
| 426 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47091 | App6Aa2 | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | 16302 | ng/ml | | | 10.1111/lam.12219 | | Larvae | 4th instar | | diet incorporation | Resistant to: Cry5B | Jakub Baranek | 2024-04-15 |
| 427 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 46660 | App6Aa2 | No | Not applicable | Rhabditida | Bursaphelenchus xylophilus | Yes | 6326 | 49.71 | µg/ml | | | 10.1016/j.jip.2022.107726 | | | | Purified protein | Addition to water | 4th stage juveniles assayed. | Colin Berry | 2024-09-02 |
| 428 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 46286 | App6Aa2 | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | 6.345 | µg/ml | | | 10.1007/s00253-013-5249-3 | | Larvae | 4th Instar | | | Concentration measured in GI50, not lc50 | Colin Berry | 2023-01-31 |
| 429 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47143 | App6Aa2 | No | Not applicable | Rhabditida | Meloidogyne hapla | Yes | 6305 | 23.9 | µg/ml | | | 10.1128/AEM.01346-08 | | | | Purified protein | | J2 stage assayed | Colin Berry | 2024-06-06 |
| 430 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 129619 | App6Aa2 | No | Not applicable | Hemiptera | Diaphorina citri | Yes | 121845 | | | | 45% mortality at 500µg/ml | 10.1016/j.jip.2024.108122 | | Adults | | Purified protein | Membrane feeding | Tryspin activated | Colin Berry | 2024-06-13 |
| 431 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 138956 | App6Aa2 | No | Not applicable | Rhabditida | Meloidogyne hapla | Yes | 6305 | 71.08 | µg/ml | | | 10.1016/j.jip.2014.12.011 | | | J2 | Solubilised crystals | | | Colin Berry | 2025-09-04 |
| 432 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47083 | App6Aa2 | No | Not applicable | Rhabditida | Meloidogyne incognita | Yes | 6303 | 383.42 | µg/ml | | | 10.1111/j.1751-7915.2011.00295.x | | | | Purified protein | | J2 stage assayed | Colin Berry | 2024-07-04 |
| 433 | MIIDSKTTLPRHSLIHTIKLNSNKKYGPGDMTNGNQFIISKQEWATIGAYIQTGLGLPVNEQQLRTHVNLSQDISIPSDF
SQLYDVYCSDKTSAEWWNKNLYPLIIKSANDIASYGFKVAGDPSIKKDGYFKKLQDELDNIVDNNSDDDAIAKAIKDFKA
RCGILIKEAKQYEEAAKNIVTSLDQFLHGDQKKLEGVINIQKRLKEVQTALNQAHGESSPAHKELLEKVKNLKTTLERTI
KAEQDLEKKVEYSFLLGPLLGFVVYEILENTAVQHIKNQIDEIKKQLDSAQHDLDRDVKIIGMLNSINTDIDNLYSQGQE
AIKVFQKLQGIWATIGAQIENLRTTSLQEVQDSDDADEIQIELEDASDAWLVVAQEARDFTLNAYSTNSRQNLPINVISD
SCNCSTTNMTSNQYSNPTTNMTSNQYMISHEYTSLPNNFMLSRNSNLEYKCPENNFMIYWYNNSDWYNNSDWYNN
| 47404 | App6Aa2 | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | | | | approx. 40% at 10 µg/ml | 10.1371/journal.ppat.1008501 | | Larvae | 1st Instar | Purified protein | Addition to water | | Leopoldo Palma | 2024-02-22 |
| 434 | MILGNGKTLPKHIRLAHIFATQNSSAKKDNPLGPEGMVTKDGFIISKEEWAFVQAYVTTGTGLPINDDEMRRHVGLPSRI
QIPDDFNQLYKVYNEDKHLCSWWNGFLFPLVLKTANDISAYGFKCAGKGATKGYYEVMQDDVENISDNGYDKVAQEKAHK
DLQARCKILIKEADQYKAAADDVSKHLNTFLKGGQDSDGNDVIGVEAVQVQLAQVKDNLDGLYGDKSPRHEELLKKVDDL
KKELEAAIKAENELEKKVKMSFALGPLLGFVVYEILELTAVKSIHKKVEALQAELDTANDELDRDVKILGMMNSIDTDID
NMLEQGEQALVVFRKIAGIWSVISLNIGNLRETSLKEIEEENDDDALYIELGDAAGQWKEIAEEAQSFVLNAYTP
| 46894 | App6Ba1 | No | Not applicable | Rhabditida | Panagrellus redivivus | No | 6233 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-30 |
| 435 | MILGNGKTLPKHIRLAHIFATQNSSAKKDNPLGPEGMVTKDGFIISKEEWAFVQAYVTTGTGLPINDDEMRRHVGLPSRI
QIPDDFNQLYKVYNEDKHLCSWWNGFLFPLVLKTANDISAYGFKCAGKGATKGYYEVMQDDVENISDNGYDKVAQEKAHK
DLQARCKILIKEADQYKAAADDVSKHLNTFLKGGQDSDGNDVIGVEAVQVQLAQVKDNLDGLYGDKSPRHEELLKKVDDL
KKELEAAIKAENELEKKVKMSFALGPLLGFVVYEILELTAVKSIHKKVEALQAELDTANDELDRDVKILGMMNSIDTDID
NMLEQGEQALVVFRKIAGIWSVISLNIGNLRETSLKEIEEENDDDALYIELGDAAGQWKEIAEEAQSFVLNAYTP
| 46893 | App6Ba1 | No | Not applicable | Rhabditida | Distolabrellus veechi | No | 96664 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-29 |
| 436 | MILGNGKTLPKHIRLAHIFATQNSSAKKDNPLGPEGMVTKDGFIISKEEWAFVQAYVTTGTGLPINDDEMRRHVGLPSRI
QIPDDFNQLYKVYNEDKHLCSWWNGFLFPLVLKTANDISAYGFKCAGKGATKGYYEVMQDDVENISDNGYDKVAQEKAHK
DLQARCKILIKEADQYKAAADDVSKHLNTFLKGGQDSDGNDVIGVEAVQVQLAQVKDNLDGLYGDKSPRHEELLKKVDDL
KKELEAAIKAENELEKKVKMSFALGPLLGFVVYEILELTAVKSIHKKVEALQAELDTANDELDRDVKILGMMNSIDTDID
NMLEQGEQALVVFRKIAGIWSVISLNIGNLRETSLKEIEEENDDDALYIELGDAAGQWKEIAEEAQSFVLNAYTP
| 46891 | App6Ba1 | No | Not applicable | Rhabditida | Acrobeloides sp. | No | 70201 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-27 |
| 437 | MILGNGKTLPKHIRLAHIFATQNSSAKKDNPLGPEGMVTKDGFIISKEEWAFVQAYVTTGTGLPINDDEMRRHVGLPSRI
QIPDDFNQLYKVYNEDKHLCSWWNGFLFPLVLKTANDISAYGFKCAGKGATKGYYEVMQDDVENISDNGYDKVAQEKAHK
DLQARCKILIKEADQYKAAADDVSKHLNTFLKGGQDSDGNDVIGVEAVQVQLAQVKDNLDGLYGDKSPRHEELLKKVDDL
KKELEAAIKAENELEKKVKMSFALGPLLGFVVYEILELTAVKSIHKKVEALQAELDTANDELDRDVKILGMMNSIDTDID
NMLEQGEQALVVFRKIAGIWSVISLNIGNLRETSLKEIEEENDDDALYIELGDAAGQWKEIAEEAQSFVLNAYTP
| 46312 | App6Ba1 | No | Not applicable | Coleoptera | Hypera postica | Yes | 36757 | 280 | ng/ml | | | 10.1007/s00284-010-9749-4 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2023-02-26 |
| 438 | MILGNGKTLPKHIRLAHIFATQNSSAKKDNPLGPEGMVTKDGFIISKEEWAFVQAYVTTGTGLPINDDEMRRHVGLPSRI
QIPDDFNQLYKVYNEDKHLCSWWNGFLFPLVLKTANDISAYGFKCAGKGATKGYYEVMQDDVENISDNGYDKVAQEKAHK
DLQARCKILIKEADQYKAAADDVSKHLNTFLKGGQDSDGNDVIGVEAVQVQLAQVKDNLDGLYGDKSPRHEELLKKVDDL
KKELEAAIKAENELEKKVKMSFALGPLLGFVVYEILELTAVKSIHKKVEALQAELDTANDELDRDVKILGMMNSIDTDID
NMLEQGEQALVVFRKIAGIWSVISLNIGNLRETSLKEIEEENDDDALYIELGDAAGQWKEIAEEAQSFVLNAYTP
| 46892 | App6Ba1 | No | Not applicable | Rhabditida | Caenorhabditis elegans | No | 6239 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-28 |
| 439 | MILGNGKTLPKHIRLAHIFATQNSSAKKDNPLGPEGMVTKDGFIISKEEWAFVQAYVTTGTGLPINDDEMRRHVGLPSRI
QIPDDFNQLYKVYNEDKHLCSWWNGFLFPLVLKTANDISAYGFKCAGKGATKGYYEVMQDDVENISDNGYDKVAQEKAHK
DLQARCKILIKEADQYKAAADDVSKHLNTFLKGGQDSDGNDVIGVEAVQVQLAQVKDNLDGLYGDKSPRHEELLKKVDDL
KKELEAAIKAENELEKKVKMSFALGPLLGFVVYEILELTAVKSIHKKVEALQAELDTANDELDRDVKILGMMNSIDTDID
NMLEQGEQALVVFRKIAGIWSVISLNIGNLRETSLKEIEEENDDDALYIELGDAAGQWKEIAEEAQSFVLNAYTP
| 46895 | App6Ba1 | No | Not applicable | Rhabditida | Pristionchus pacificus | No | 54126 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-01-10 |
| 440 | | 131642 | Axmi002 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | >75% mortality | | CA2754845A1 | | | Purified protein | | No concentration was given for observed mortality. Assay methodology was not described | Victoria Valby | 2023-12-18 |
| 441 | | 131639 | Axmi002 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | CA2754845A1 | | | Purified protein | | Assay methodology was not described. No LC50 or percent mortality was given but it was stated that there was stunting observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 442 | | 131640 | Axmi002 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | CA2754845A1 | | | Purified protein | | Assay methodology was not described. No LC50 or percent mortality was given but it was stated that there was strong stunting and some mortality observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 443 | | 131641 | Axmi002 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | >50% mortality | | CA2754845A1 | | | Purified protein | | Assay methodology was not described. No LC50 or percent mortality was given but it was stated that there was strong stunting observed and >50% mortality against the indicated insect species | Victoria Valby | 2023-12-18 |
| 444 | | 47831 | Axmi004 | No | Not applicable | Hemiptera | Lygus lineolaris | Yes | 50650 | | | | 50% at 0.4 µg/µl | | US8173590B2 | nymph | 1st and 2nd Instar | | | It was stated that after performing electrophoresis, the concentratinon of the protein sample used was determined to be 0.4 ?g/ul | Victoria Valby | 2024-04-25 |
| 445 | | 131648 | Axmi005 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | 100% at 40 µl | | CA2728622A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was uniform stunting and 100% mortality observed against the indicated insect species at 40 µl | Victoria Valby | 2023-12-18 |
| 446 | | 131647 | Axmi005 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | CA2728622A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was uniform stunting and mortality observed against the indicated insect species at 40 µl | Victoria Valby | 2023-12-18 |
| 447 | | 131643 | Axmi005 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | CA2728622A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was uniform stunting and mortality observed against the indicated insect species at 40 µl | Victoria Valby | 2023-12-18 |
| 448 | | 131644 | Axmi005 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | CA2728622A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was uniform stunting and mortality observed against the indicated insect species at 40 µl | Victoria Valby | 2023-12-18 |
| 449 | | 131645 | Axmi005 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | CA2728622A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was non-uniform stunting observed against the indicated insect species at 40 µl | Victoria Valby | 2023-12-18 |
| 450 | | 131646 | Axmi005 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | CA2728622A1 | | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was uniform stunting and mortality observed against the indicated insect species at 40 µl | Victoria Valby | 2023-12-18 |
| 451 | | 131178 | Axmi009 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 100% at 8 µl/cm2 | | US20040210964A1 | | | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 452 | | 131342 | Axmi009 | No | Not applicable | Hemiptera | Lygus lineolaris | Yes | 50650 | | | | 50% at 6.6 µg/ml | | US20040210964A1 | nymph | | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 453 | | 131177 | Axmi009 | No | Not applicable | Coleoptera | Diabrotica undecimpunctata | Yes | 50387 | | | | 100% at 8 µl/cm2 | | US20040210964A1 | | | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 454 | | 131180 | Axmi028 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | US7803925B2 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting of the indicated insect species observed | Victoria Valby | 2023-12-18 |
| 455 | | 131179 | Axmi028 | No | Not applicable | Coleoptera | Diabrotica undecimpunctata howardi | Yes | 50388 | | | | | | US7803925B2 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting of the indicated insect species observed | Victoria Valby | 2023-12-18 |
| 456 | | 131181 | Axmi029 | No | Not applicable | Coleoptera | Diabrotica undecimpunctata howardi | Yes | 50388 | | | | | | US7803925B2 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting of the indicated insect species observed | Victoria Valby | 2023-12-18 |
| 457 | | 131182 | Axmi029 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | US7803925B2 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was stunting of the indicated insect species observed | Victoria Valby | 2023-12-18 |
| 458 | | 47786 | Axmi036 | No | Not applicable | Hemiptera | Lygus lineolaris | Yes | 50650 | | | | 60% at 175 µg/µl | | US20100137216A1 | | | | | It was stated that the protein in question was mixed at a ratio of 1:1 with a liquid diet and tested at the listed concentration of 175 µg/ul. | Victoria Valby | 2024-11-03 |
| 459 | | 47598 | Axmi066 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | CN101878222B | larvae | | Spore and/or crystal suspension | | No specific concentration , LD50, or % mortality provided- only stated there was activity observed as "++" | Victoria Valby | 2024-04-09 |
| 460 | | 47596 | Axmi066 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | CN101878222B | larvae | | Spore and/or crystal suspension | | No specific concentration , LD50, or % mortality provided- only stated there was activity observed as "++" | Victoria Valby | 2024-02-09 |
| 461 | | 47597 | Axmi066 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | CN101878222B | larvae | | Spore and/or crystal suspension | | No specific concentration , LD50, or % mortality provided- only stated there was activity observed as "++" | Victoria Valby | 2024-03-09 |
| 462 | | 47595 | Axmi066 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | CN101878222B | larvae | | Spore and/or crystal suspension | | No specific concentration , LD50, or % mortality provided- only stated there was activity observed as "+++" | Victoria Valby | 2024-01-09 |
| 463 | | 47600 | Axmi076 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | CN101878222B | larvae | | Spore and/or crystal suspension | | No specific concentration , LD50, or % mortality provided- only stated there was activity observed as "+++" | Victoria Valby | 2024-06-09 |
| 464 | | 47602 | Axmi076 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | CN101878222B | larvae | | Spore and/or crystal suspension | | No specific concentration , LD50, or % mortality provided- only stated there was activity observed as "++" | Victoria Valby | 2024-08-09 |
| 465 | | 47601 | Axmi076 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | CN101878222B | larvae | | Spore and/or crystal suspension | | No specific concentration , LD50, or % mortality provided- only stated there was activity observed as "++++" | Victoria Valby | 2024-07-09 |
| 466 | | 47599 | Axmi076 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | CN101878222B | larvae | | Spore and/or crystal suspension | | No specific concentration , LD50, or % mortality provided- only stated there was activity observed as "++++" | Victoria Valby | 2024-05-09 |
| 467 | | 47840 | Axmi113 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 20% at 40 µl | | US9909140B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 40 µl of the protein sample was added to the diet surface. | Victoria Valby | 2024-04-05 |
| 468 | | 131650 | Axmi113 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | 50% at 40 µl | | WO2010003065A2 | | | | diet incorporation | It was stated that uniform stunting was observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 469 | | 131649 | Axmi113 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 20% at 40 µl | | WO2010003065A2 | | | | diet incorporation | It was stated that uniform stunting with mortality was observed against the indicated insect species | Victoria Valby | 2023-12-18 |
| 470 | | 47841 | Axmi115 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 80% at 40 µl | | US9909140B2 | larvae | 1st Instar | | Diet incorporation | It was stated that 40 µl of the protein sample was added to the diet surface. | Victoria Valby | 2024-05-05 |
| 471 | | 131652 | Axmi115v01 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | 25% at 10 µg/ml | | CA2832087A1 | | | Purified protein | Leaf disk | | Victoria Valby | 2023-12-18 |
| 472 | | 131651 | Axmi115v01 | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | | | | 75% at 40 µg/ml | | CA2832087A1 | | | Purified protein | Leaf disk | | Victoria Valby | 2023-12-18 |
| 473 | | 131653 | Axmi115v02 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | 7.6 | µg/ml | | | | CA2832087A1 | | | Purified protein | Leaf disk | | Victoria Valby | 2023-12-18 |
| 474 | | 131656 | Axmi115v02 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | 50% at 10 µg/ml | | CA2832087A1 | | | Purified protein | Leaf disk | | Victoria Valby | 2023-12-18 |
| 475 | | 131655 | Axmi115v02 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | 339 | µg/ml | | | | CA2832087A1 | | | Purified protein | Leaf disk | | Victoria Valby | 2023-12-18 |
| 476 | | 131654 | Axmi115v02 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | 280 | ng/ml | | | | CA2832087A1 | | | Purified protein | Leaf disk | | Victoria Valby | 2023-12-18 |
| 477 | | 47836 | Axmi134 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 60% at 200 µg/µl | | US9238823B2 | | | | | | Victoria Valby | 2024-04-30 |
| 478 | | 47641 | Axmi150 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than 50% | | EP2379724B1 | | | | | No specific concentration of the dose used to achieve the observed % mortality was given. | Victoria Valby | 2024-10-17 |
| 479 | | 47643 | Axmi171.2 | No | Not applicable | Hemiptera | Lygus hesperus | Yes | 30085 | | | | 99% at 500 ppm | | EP2957638B1 | larvae | | | | For Axmi171.2 Fusion protein, it was stated that a precipitated version of the protein (cut pellet) was resuspended in water, creating a final concentration of 500 ppm. | Victoria Valby | 2024-10-19 |
| 480 | | 131658 | Axmi196 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | AU2013205250B2 | | | Purified protein | | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species. Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 481 | | 133521 | Axmi196 | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | | | | 100% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 482 | | 131657 | Axmi196 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | AU2013205250B2 | | | Purified protein | | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species. Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 483 | | 133522 | Axmi196 | No | Not applicable | Rhabditida | Pratylenchus penetrans | Yes | 45929 | | | | 40% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 484 | | 131659 | Axmi204 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 50% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality, moderate stunting observed, and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 485 | | 131660 | Axmi204 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality, severe stunting observed, and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 486 | | 47642 | Axmi205 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | 25% mortality | | EP2449109B1 | | | | | No specific concentration of the dose used to achieve the observed % mortality was given. | Victoria Valby | 2024-10-18 |
| 487 | | 131183 | Axmi207 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | Yes | 7539 | | | | 100% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 488 | | 131661 | Axmi207 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | AU2013205250B2 | | | Purified protein | | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species. Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 489 | | 131662 | Axmi207 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 100% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality, severe stunting observed, and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 490 | | 131663 | Axmi207 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | AU2013205250B2 | | | Purified protein | | No LC50 or percentage mortality was given, but it was stated that there was strong stunting observed against the indicated insect species. Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 491 | | 131665 | Axmi207 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality, severe stunting observed, and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 492 | | 131664 | Axmi207 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | 50% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality, moderate stunting observed against the indicated insect species, and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 493 | | 131669 | Axmi209 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality, severe stunting observed against the indicated insect species, and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 494 | | 131666 | Axmi209 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 50% mortality | | AU2013205250B2 | | | Purified protein | | No concentration of protein was given for observed mortality, strong stunting observed against the indicated insect species, and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 495 | | 131667 | Axmi209 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | AU2013205250B2 | | | Purified protein | | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species. Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 496 | | 131668 | Axmi209 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | AU2013205250B2 | | | Purified protein | | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species. Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 497 | | 131670 | Axmi209 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | AU2013205250B2 | | | Purified protein | | No LC50 or percentage mortality was given, but it was stated that there was stunting observed against the indicated insect species. Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 498 | | 47603 | Axmi218 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | | CN102892886A_x000D_ | | | | | No specific concentration , LD50, or % mortality provided- only stated there was "slight inhomogenous growth inhibiting" | Victoria Valby | 2024-09-09 |
| 499 | | 47835 | Axmi220 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US9156895B2 | larvae | | | Diet incorporation | No specific concentration of the dose used to achieve the observed % mortality was given. It was stated that the "protein was tested in the bioassay as a 10x concentrated pellet". | Victoria Valby | 2024-04-29 |
| 500 | | 47646 | Axmi221z | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than 75% | | HUE035576T2 | | | Purified protein | | A truncated version of the protein was used to achieve this result, sever stunt. No specific concentration of the dose used to achieve the observed % mortality was given. It was stated that the "protein was tested in the bioassay as a 10x concentrated pellet". | Victoria Valby | 2024-10-22 |
| 501 | | 47647 | Axmi222z | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than 75% | | HUE035576T2 | | | Purified protein | | Severe stunting observed. No specific concentration of the dose used to achieve the observed % mortality was given. It was stated that the "protein was tested in the bioassay as a 10x concentrated pellet". | Victoria Valby | 2024-10-23 |
| 502 | | 47648 | Axmi223z | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than 75% | | HUE035576T2 | | | Purified protein | | Severe stunting observed. No specific concentration of the dose used to achieve the observed % mortality was given. It was stated that the "protein was tested in the bioassay as a 10x concentrated pellet". | Victoria Valby | 2024-10-24 |
| 503 | | 47649 | Axmi224z | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | greater than 75% | | HUE035576T2 | | | Purified protein | | Alternate start point on gene with plasmid pAX7634, severe stunting observed. No specific concentration of the dose used to achieve the observed % mortality was given. It was stated that the "protein was tested in the bioassay as a 10x concentrated pellet". | Victoria Valby | 2024-10-25 |
| 504 | | 47650 | Axmi225z | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | greater than 75% | | HUE035576T2 | | | Purified protein | | Truncated version of gene with plasmid pAX6891, severe stunting observed. No specific concentration of the dose used to achieve the observed % mortality was given. It was stated that the "protein was tested in the bioassay as a 10x concentrated pellet". | Victoria Valby | 2024-10-26 |
| 505 | | 47837 | Axmi238 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US9321814B2 | | | | | No specific concentration of the dose used to achieve the observed % mortality was given. | Victoria Valby | 2024-01-05 |
| 506 | | 47604 | Axmi277 | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | | | | 80% mortality | | CN103998610A | | | | | No specific concentration of the dose used to achieve the observed % mortality was given. | Victoria Valby | 2024-10-09 |
| 507 | | 131675 | Axmi335 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US10316329B2 | larvae | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was activity against the specified insect observed | Victoria Valby | 2023-12-18 |
| 508 | | 131674 | Axmi335 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US10316329B2 | larvae | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was activity against the specified insect observed | Victoria Valby | 2023-12-18 |
| 509 | | 47644 | Axmi335 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 25% mortality | | ES2630059T3 | larvae | | Purified protein | | No specific concentration of protein was given for the observed mortality. | Victoria Valby | 2024-10-20 |
| 510 | | 131676 | Axmi335 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US10316329B2 | larvae | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was activity against the specified insect observed | Victoria Valby | 2023-12-18 |
| 511 | | 131672 | Axmi335 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US10316329B2 | larvae | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was activity against the specified insect observed | Victoria Valby | 2023-12-18 |
| 512 | | 131673 | Axmi335 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | US10316329B2 | larvae | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was activity against the specified insect observed | Victoria Valby | 2023-12-18 |
| 513 | | 131671 | Axmi335 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US10316329B2 | larvae | | | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was activity against the specified insect observed | Victoria Valby | 2023-12-18 |
| 514 | | 47839 | Axmi345 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US9725735B2 | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed % mortality was given. | Victoria Valby | 2024-03-05 |
| 515 | | 47651 | Axmi368 | No | Not applicable | Hemiptera | Aphis glycines | Yes | 307491 | | | | greater than 75 | | JP6957583B2 | Larvae | | | Diet incorporation | No specific concentration , LC50, or % mortality provided- only stated that there was intense uniform stunting (74-26% size of control) and a mortality % of > 75. | Victoria Valby | 2024-10-27 |
| 516 | | 47652 | Axmi400 | No | Not applicable | Hemiptera | Aphis glycines | Yes | 307491 | | | | greater than or = 75% | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was slight stunting (75% size of control) and mortality % of 75 or less. A truncated version of the protein was used. | Victoria Valby | 2024-10-28 |
| 517 | | 47653 | Axmi402 | No | Not applicable | Hemiptera | Aphis glycines | Yes | 307491 | | | | greater than or = 25% | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was slight stunting (75% size of control) and mortality % of 25 or less. | Victoria Valby | 2024-10-29 |
| 518 | | 47654 | Axmi403 | No | Not applicable | Hemiptera | Aphis glycines | Yes | 307491 | | | | greater than or = 75% | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was slight stunting (75% size of control) and mortality % of 75 or less. A truncated version of the protein was used. | Victoria Valby | 2024-10-30 |
| 519 | | 47655 | Axmi404.2 | No | Not applicable | Hemiptera | Aphis glycines | Yes | 307491 | | | | greater than or = 50% | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was slight stunting (75% size of control) and mortality % of 50 or less. A truncated version of the protein was used. | Victoria Valby | 2024-10-31 |
| 520 | | 47656 | Axmi405.2 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than or = 50 | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was slight stunting (75% size of control) and mortality % of 50 or less. A truncated version of the protein was used. | Victoria Valby | 2024-01-11 |
| 521 | | 47657 | Axmi416 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than 75% | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was intense uniform stunting (74-26% size of control) and a mortality % of > 75. A truncated version of the protein was used. | Victoria Valby | 2024-02-11 |
| 522 | | 47658 | Axmi417 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than 75% | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was intense uniform stunting (74-26% size of control) and a mortality % of > 75. A truncated version of the protein was used. | Victoria Valby | 2024-03-11 |
| 523 | | 47659 | Axmi423 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than 75% | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was intense uniform stunting (74-26% size of control) and a mortality % of > 75. A truncated version of the protein was used. | Victoria Valby | 2024-04-11 |
| 524 | | 47660 | Axmi424 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than 75% | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was intense uniform stunting (74-26% size of control) and a mortality % of > 75. A truncated version of the protein was used. | Victoria Valby | 2024-05-11 |
| 525 | | 47661 | Axmi425 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | greater than 75% | | JP6957583B2 | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated that there was intense uniform stunting (74-26% size of control) and a mortality % of > 75. A truncated version of the protein was used. | Victoria Valby | 2024-06-11 |
| 526 | | 131677 | Axmi440 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | 25% mortality | | EP3030572B1 | | | Purified protein | | No concentration of protein was given for observed mortality and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 527 | | 131678 | Axmi440 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 50% mortality | | EP3030572B1 | | | Purified protein | | No concentration of protein was given for observed mortality and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 528 | | 131679 | Axmi440 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | EP3030572B1 | | | Purified protein | | No concentration of protein was given for observed mortality and assay methodology not described. | Victoria Valby | 2023-12-18 |
| 529 | | 47765 | Axmi440 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US10221430B2 | | | | | No specific concentration of the dose used to achieve the observed % mortality was given. | Victoria Valby | 2024-02-18 |
| 530 | | 47672 | Axmi477 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | | KR20160094985A_x000D_ | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was heavily uniform growth inhibition observed. | Victoria Valby | 2024-11-17 |
| 531 | | 47669 | Axmi477 | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | | | | | | KR20160094985A | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed growth inhibition was given but "strong and uniform growth inhibition" reported. | Victoria Valby | 2024-11-14 |
| 532 | | 47663 | Axmi477 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | 100% mortality | | KR20160094985A | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed % mortality was given. 100% mortality was reported as well as "heavily uniform growth inhibition" | Victoria Valby | 2024-08-11 |
| 533 | | 47662 | Axmi477 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | KR20160094985A | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed growth inhibition was given but "heavily uniform growth inhibition" reported | Victoria Valby | 2024-07-11 |
| 534 | | 47666 | Axmi477 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | 25% mortality | | KR20160094985A | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed % mortality was given. 25% mortality was reported as well as a "little uniform growth inhibition" | Victoria Valby | 2024-11-11 |
| 535 | | 131686 | Axmi477 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 536 | | 131685 | Axmi477 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | 25% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, strong uniform stunting observed | Victoria Valby | 2023-12-18 |
| 537 | | 131684 | Axmi477 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | 75% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 538 | | 131683 | Axmi477 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | 25% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, slight uniform stunting observed | Victoria Valby | 2023-12-18 |
| 539 | | 131682 | Axmi477 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 25% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, strong uniform stunting observed | Victoria Valby | 2023-12-18 |
| 540 | | 47664 | Axmi477 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 25% mortality | | KR20160094985A | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed % mortality was given. 25% mortality was reported as well as stunting that fell in between a score of 3 (strong and uniform growth inhibition) and 4 (heavily uniform growth inhibition) | Victoria Valby | 2024-09-11 |
| 541 | | 47665 | Axmi477 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | KR20160094985A | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed growth inhibition, but stunting reported that fell in between a score of 3 (strong and uniform growth inhibition) and 4 (heavily uniform growth inhibition) | Victoria Valby | 2024-10-11 |
| 542 | | 47667 | Axmi477 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | 75% mortality | | KR20160094985A | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed % mortality was given. 75% mortality was reported as well as "heavily uniform growth inhibition" | Victoria Valby | 2024-12-11 |
| 543 | | 131681 | Axmi477 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | 100% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 544 | | 131680 | Axmi477 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | 100% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 545 | | 47668 | Axmi477 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | 25% mortality | | KR20160094985A | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed % mortality was given. 25% mortality was reported as well as "strong and uniform growth inhibition" | Victoria Valby | 2024-11-13 |
| 546 | | 47670 | Axmi477 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | KR20160094985A | | | | Diet incorporation | No specific concentration of the dose used to achieve the observed growth inhibition was given but "nonuniform growth inhibition" reported. | Victoria Valby | 2024-11-15 |
| 547 | | 131690 | Axmi482 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 548 | | 47671 | Axmi482 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | | KR20160094985A | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was heavily uniform growth inhibition observed. | Victoria Valby | 2024-11-16 |
| 549 | | 131687 | Axmi482 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | 75% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 550 | | 131688 | Axmi482 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 50% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 551 | | 131689 | Axmi482 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | 1% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, strong uniform stunting observed | Victoria Valby | 2023-12-18 |
| 552 | | 47674 | Axmi486 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | | KR20160094985A | Larvae | | | Diet incorporation | No specific concentration , LC50, or % mortality provided- only stated there was heavily uniform growth inhibition observed. | Victoria Valby | 2024-11-19 |
| 553 | | 131693 | Axmi486 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | 25% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, slight uniform stunting observed | Victoria Valby | 2023-12-18 |
| 554 | | 131692 | Axmi486 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 50% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, strong uniform stunting observed | Victoria Valby | 2023-12-18 |
| 555 | | 131691 | Axmi486 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | 37% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 556 | | 131694 | Axmi486 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 557 | | 131699 | Axmi525 | No | Not applicable | Lepidoptera | Spodoptera eridania | Yes | 37547 | | | | 70% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, strong uniform stunting observed | Victoria Valby | 2023-12-18 |
| 558 | | 131698 | Axmi525 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 559 | | 131697 | Axmi525 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 83% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 560 | | 131696 | Axmi525 | No | Not applicable | Lepidoptera | Diatraea crambidoides | Yes | 236798 | | | | 66% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 561 | | 47673 | Axmi525 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | | KR20160094985A_x000D_ | larvae | | | Diet incorporation | No specific concentration , LD50, or % mortality provided- only stated there was heavily uniform growth inhibition observed. | Victoria Valby | 2024-11-18 |
| 562 | | 131695 | Axmi525 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | 42% mortality | | US20210371473A1 | | | Purified protein | | No concentration of protein was given for observed mortality, severe uniform stunting observed | Victoria Valby | 2023-12-18 |
| 563 | | 131700 | Axmi669 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | 100% mortality | | US11091772B2 | | | Purified protein | | No concentration of protein was given for observed mortality and severe uniform stunting of the indicated insect species was also observed (less than 25% the size of controls). Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 564 | | 131701 | Axmi669 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US11091772B2 | | | Purified protein | | No concentration of protein was given for observed mortality and severe uniform stunting of the indicated insect species was also observed (less than 25% the size of controls). Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 565 | | 131703 | Axmi991 | No | Not applicable | Lepidoptera | Spodoptera eridania | Yes | 37547 | | | | 100% mortality | | US11091772B2 | | | Purified protein | | No concentration of protein was given for observed mortality and severe uniform stunting of the indicated insect species was also observed (less than 25% the size of controls). Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 566 | | 131702 | Axmi991 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100% mortality | | US11091772B2 | | | Purified protein | | No concentration of protein was given for observed mortality and severe uniform stunting of the indicated insect species was also observed (less than 25% the size of controls). Assay methodology not described. | Victoria Valby | 2023-12-18 |
| 567 | | 131704 | BCW001 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 568 | | 131710 | BCW001 | No | Not applicable | Lepidoptera | Trichoplusia ni | Yes | 7111 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 569 | | 131709 | BCW001 | No | Not applicable | Lepidoptera | Striacosta albicosta | Yes | 437490 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 570 | | 131708 | BCW001 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 571 | | 131707 | BCW001 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was "mortality observed" against the specified organism. | Victoria Valby | 2023-12-18 |
| 572 | | 131706 | BCW001 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 573 | | 131705 | BCW001 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 574 | | 131711 | BCW002 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 575 | | 131712 | BCW002 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 576 | | 131714 | BCW002 | No | Not applicable | Lepidoptera | Striacosta albicosta | Yes | 437490 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 577 | | 131713 | BCW002 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 578 | | 131722 | BCW003 | No | Not applicable | Lepidoptera | Trichoplusia ni | Yes | 7111 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 579 | | 131718 | BCW003 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 580 | | 131719 | BCW003 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 581 | | 131720 | BCW003 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 582 | | 131721 | BCW003 | No | Not applicable | Lepidoptera | Striacosta albicosta | Yes | 437490 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 583 | | 131715 | BCW003 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 584 | | 131716 | BCW003 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 585 | | 131717 | BCW003 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | WO2018132556A1 | | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was mortality observed against the specified organism. | Victoria Valby | 2023-12-18 |
| 586 | | 46691 | BLB459 | No | Not applicable | Lepidoptera | Spodoptera littoralis | Yes | 7109 | | | | 82.5% mortality | 10.1016/j.toxicon.2017.02.018 | | larvae | 1st Instar | | Free ingestion technique | No specific concentration of the protein concentration used to achieve the observed % mortality was given. | Victoria Valby | 2024-11-03 |
| 587 | | 131729 | BT-0022 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | 100% mortality | | WO2020172119A1 | larvae | | | | Concentration used to obtain observed mortality percentage was not specified | Victoria Valby | 2023-12-18 |
| 588 | | 131724 | BT-0022 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | 100% mortality | | WO2020172119A1 | larvae | | | | Concentration used to obtain observed mortality percentage was not specified | Victoria Valby | 2023-12-18 |
| 589 | | 131723 | BT-0022 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | 100% mortality | | WO2020172119A1 | larvae | | | | Concentration used to obtain observed mortality percentage was not specified | Victoria Valby | 2023-12-18 |
| 590 | | 131725 | BT-0022 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | 100% mortality | | WO2020172119A1 | larvae | | | | Concentration used to obtain observed mortality percentage was not specified | Victoria Valby | 2023-12-18 |
| 591 | | 131726 | BT-0022 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | 92% mortality | | WO2020172119A1 | larvae | | | | Concentration used to obtain observed mortality percentage was not specified | Victoria Valby | 2023-12-18 |
| 592 | | 131728 | BT-0022 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | 42% mortality | | WO2020172119A1 | larvae | | | | Concentration used to obtain observed mortality percentage was not specified, "small" larvae used | Victoria Valby | 2023-12-18 |
| 593 | | 131727 | BT-0022 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | 20% mortality | | WO2020172119A1 | larvae | | | | Concentration used to obtain observed mortality percentage was not specified, "medium" larvae used | Victoria Valby | 2023-12-18 |
| 594 | | 131739 | BT0001 | No | Not applicable | Lepidoptera | Striacosta albicosta | Yes | 437490 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 595 | | 131738 | BT0001 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 596 | | 131737 | BT0001 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 597 | | 131736 | BT0001 | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 598 | | 131735 | BT0001 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 599 | | 131734 | BT0001 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 600 | | 131733 | BT0001 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 601 | | 131732 | BT0001 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 602 | | 131731 | BT0001 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 603 | | 131730 | BT0001 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 604 | | 132639 | BT0003 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 605 | | 131740 | BT0003 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 606 | | 132638 | BT0003 | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 607 | | 132636 | BT0003 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 608 | | 132637 | BT0003 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 609 | | 131743 | BT0003 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 610 | | 131742 | BT0003 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 611 | | 131741 | BT0003 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 612 | | 132641 | BT0003 | No | Not applicable | Lepidoptera | Striacosta albicosta | Yes | 437490 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 613 | | 132640 | BT0003 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 614 | | 132644 | BT0020 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 615 | | 132643 | BT0020 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 616 | | 132649 | BT0020 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 617 | | 132650 | BT0020 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 618 | | 132646 | BT0020 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 619 | | 132647 | BT0020 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 620 | | 132651 | BT0020 | No | Not applicable | Lepidoptera | Striacosta albicosta | Yes | 437490 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 621 | | 132645 | BT0020 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 622 | | 132648 | BT0020 | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 623 | | 132642 | BT0020 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 624 | | 132657 | BT0022 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 625 | | 132656 | BT0022 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 626 | | 132652 | BT0022 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 627 | | 132655 | BT0022 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 628 | | 132654 | BT0022 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 629 | | 132653 | BT0022 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 630 | | 132659 | BT0027 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 631 | | 132658 | BT0027 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 632 | | 132660 | BT0029 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 633 | | 132661 | BT0029 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 634 | | 132667 | BT0029 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 635 | | 132666 | BT0029 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 636 | | 132665 | BT0029 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 637 | | 132664 | BT0029 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 638 | | 132663 | BT0029 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 639 | | 132662 | BT0029 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 640 | | 132671 | BT0030 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 641 | | 132668 | BT0030 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 642 | | 132670 | BT0030 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 643 | | 132669 | BT0030 | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 644 | | 132672 | BT0030 | No | Not applicable | Lepidoptera | Striacosta albicosta | Yes | 437490 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 645 | | 132673 | BT0031 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 646 | | 132674 | BT0044 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 647 | | 132675 | BT0044 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was either 0-10% activity or 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 648 | | 132681 | BT0051 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was either 0-10% activity or 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 649 | | 132679 | BT0051 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 650 | | 132678 | BT0051 | No | Not applicable | Lepidoptera | Cnaphalocrocis medinalis | Yes | 437488 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 651 | | 132677 | BT0051 | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 652 | | 132676 | BT0051 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 653 | | 132684 | BT0051 | No | Not applicable | Lepidoptera | Sesamia inferens | Yes | 492764 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 654 | | 132685 | BT0051 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 655 | | 132683 | BT0051 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 656 | | 132682 | BT0051 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 657 | | 132680 | BT0051 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 658 | | 132690 | BT0068 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 659 | | 132686 | BT0068 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 660 | | 132687 | BT0068 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 661 | | 132688 | BT0068 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 662 | | 132689 | BT0068 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 663 | | 132695 | BT0128 | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was either 0-10% activity or 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 664 | | 132692 | BT0128 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 665 | | 132694 | BT0128 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 666 | | 132693 | BT0128 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 667 | | 132696 | BT0128 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 668 | | 132691 | BT0128 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 669 | | 132697 | BT0128 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 670 | | 132698 | BT0128 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US11261459B2 | larvae | | Purified protein | Diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was either 0-10% activity or 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 671 | | 132699 | BT0201 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 672 | | 132703 | BT0201 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 673 | | 132702 | BT0201 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 674 | | 132701 | BT0201 | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 675 | | 132700 | BT0201 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 676 | | 132704 | BT0202 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 677 | | 132710 | BT0202 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 678 | | 132709 | BT0202 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 26-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 679 | | 132708 | BT0202 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 680 | | 132707 | BT0202 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 681 | | 132706 | BT0202 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity and 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 682 | | 132705 | BT0202 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20200283793A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 76-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 683 | | 132711 | BT1047 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 684 | | 132712 | BT1047 | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 685 | | 132713 | BT1047 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 686 | | 131184 | BT1280 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 687 | | 132714 | BT1280 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 688 | | 132717 | BT1537 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 689 | | 132718 | BT1537 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 690 | | 132715 | BT1537 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 691 | | 132716 | BT1537 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 692 | | 132719 | BT1537 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 693 | | 131185 | BT1537 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 694 | | 132723 | BT1538 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 695 | | 132720 | BT1538 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 696 | | 131186 | BT1538 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 697 | | 132721 | BT1538 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 698 | | 132722 | BT1538 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 699 | | 132724 | BT1538 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US20220089658A1 | larvae | | Purified protein | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 700 | | 132726 | BT1555 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 701 | | 132725 | BT1555 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 702 | | 132727 | BT1555 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 703 | | 132728 | BT1563 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 704 | | 132729 | BT1563 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 705 | | 132730 | BT1571 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 706 | | 132733 | BT1571 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 707 | | 132732 | BT1571 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 708 | | 132731 | BT1571 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 709 | | 132735 | BT204 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 710 | | 132734 | BT204 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 711 | | 132736 | BT264 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 712 | | 132737 | BT264 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 713 | | 132738 | BT288 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 714 | | 132744 | BT302 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 715 | | 132743 | BT302 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 716 | | 132745 | BT302 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 717 | | 132746 | BT454 | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 718 | | 132747 | BT454 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 719 | | 132748 | BT485 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 720 | | 132749 | BT485 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | WO2020050905A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity against the specified organism compared to control group | Victoria Valby | 2023-12-18 |
| 721 | | 132750 | BT645 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 722 | | 132756 | BT645 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 723 | | 132755 | BT645 | No | Not applicable | Lepidoptera | Spodoptera eridania | Yes | 37547 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 724 | | 132754 | BT645 | No | Not applicable | Lepidoptera | Spodoptera cosmioides | Yes | 134402 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 725 | | 132753 | BT645 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 726 | | 132752 | BT645 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 727 | | 132751 | BT645 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 75-100% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 728 | | 131187 | BT645 | No | Not applicable | Coleoptera | Diabrotica virgifera virgifera | Yes | 50390 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 729 | | 132757 | BT727 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 0-10% activity/ 0% mortality with strong larval growth inhibition observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 730 | | 132759 | BT727 | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 10-25% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 731 | | 132758 | BT727 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | | | | | | US20220322680A1 | larvae | | | diet incorporation | No LC50 or percentage mortality was given, but it was stated that there was 25-75% activity observed against the specific pest, compared to the control group | Victoria Valby | 2023-12-18 |
| 732 | | 47463 | BTRX1 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | 40% at 300 µg/ml | 10.21161/mjm.00707 | | larvae | 2nd Instar | spore crystal mixture | Diet incorporation | 300 µg/ml of the spore crystal mixture was used to achieve observed mortality. | Victoria Valby | 2024-04-22 |
| 733 | | 47464 | BTRX17 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | 90% at 300 µg/ml | 10.21161/mjm.00707 | | larvae | 2nd Instar | spore crystal mixture | Diet incorporation | 300 µg/ml of the spore crystal mixture was used to achieve observed mortality. | Victoria Valby | 2024-04-23 |
| 734 | | 47465 | BTRX2 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | 60% at 300 µg/ml | 10.21161/mjm.00707 | | larvae | 2nd Instar | spore crystal mixture | Diet incorporation | 300 µg/ml of the spore crystal mixture was used to achieve observed mortality. | Victoria Valby | 2024-04-24 |
| 735 | | 47466 | BTRX24 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | 100% at 300 µg/ml | 10.21161/mjm.00707 | | larvae | 2nd Instar | spore crystal mixture | Diet incorporation | 300 µg/ml of the spore crystal mixture was used to achieve observed mortality. | Victoria Valby | 2024-04-25 |
| 736 | | 47467 | BTRX3 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | 80% at 300 µg/ml | 10.21161/mjm.00707 | | larvae | 2nd Instar | spore crystal mixture | Diet incorporation | 300 µg/ml of the spore crystal mixture was used to achieve observed mortality. | Victoria Valby | 2024-04-26 |
| 737 | | 47788 | BTS01099E | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | 100% at 25 µl | | US20160249625A1 | larvae | | spore crystal mixture | Diet incorporation | Mixtures of crystals and spores from listed strains were used as insecticidal agents. It was stated that 25 ?l of the protein extract was placed on the surface of the diet. | Victoria Valby | 2024-03-13 |
| 738 | | 47789 | BTS02761A | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | | | | 94% at 25 µl | | US20160249625A1 | larvae | | spore crystal mixture | Diet incorporation | Mixtures of crystals and spores from listed strains were used as insecticidal agents. It was stated that 25 ?l of the protein extract was placed on the surface of the diet. | Victoria Valby | 2024-03-14 |
| 739 | | 46692 | BUPM95 | No | Not applicable | Lepidoptera | Spodoptera littoralis | Yes | 7109 | | | | 76.5% mortality | 10.1016/j.toxicon.2017.02.018 | | larvae | 1st Instar | | Free ingestion technique | No specific concentration of the protein concentration used to achieve the observed % mortality was given. | Victoria Valby | 2024-12-03 |
| 740 | | 138414 | Bacillus bombysepticus alpha toxin | No | Not applicable | Lepidoptera | Bombyx mori | Yes | 7091 | | | | | 10.1371/journal.ppat.1005527 | | Cultured cells | | | | Treated cells died | Colin Berry | 2025-09-04 |
| 741 | | 138413 | Bacillus bombysepticus alpha toxin | No | Not applicable | Lepidoptera | Bombyx mori | Yes | 7091 | 66.1µg/larva | | | | 10.1371/journal.ppat.1005527 | | Larvae | 5th instar | | Leaf dip | Activity expressed as LD50. LD50 for 4th instars ~34.5µg/larva | Colin Berry | 2025-09-04 |
| 742 | | 132739 | Bt29-1Ca | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | 100% at 2 µg/cm2 | | WO2018111553A1 | larvae | | | diet incorporation | BT-0029 chimeric protein | Victoria Valby | 2023-12-18 |
| 743 | | 132740 | Bt29-1Fa | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | 100% at 500 ng/cm2 | | WO2018111553A1 | larvae | | Purified protein | diet incorporation | BT-0029 chimeric protein | Victoria Valby | 2023-12-18 |
| 744 | | 132741 | Bt29-1Kav2 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | 75% at 2 µg/cm2 | | WO2018111553A1 | larvae | | | diet incorporation | BT-0029 chimeric protein | Victoria Valby | 2023-12-18 |
| 745 | | 132742 | Bt29-Bt22 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | 90% at 125 ng/cm2 | | WO2018111553A1 | larvae | | Purified protein | diet incorporation | BT-0029 chimeric protein | Victoria Valby | 2023-12-18 |
| 746 | | 46431 | Bto-UNVM_94 | No | Not applicable | Lepidoptera | Cydia pomonella | Yes | 82600 | | | | 54.2% at 5 µg/µl | 10.1016/j.biocontrol.2022.104838 | | larvae | 1st Instar | spore crystal mixture | Diet incorporation | It was stated that the spore-crystal complex (suspension of strain) that was used was 5 µg/ul. | Victoria Valby | 2023-06-25 |
| 747 | | 137755 | C1V3 | No | Not applicable | Lepidoptera | Maruca vitrata | Yes | 497515 | | | | 1 | 10.1002/ps.8863 | | Larvae | 2nd instar | Transgenic plant | Transgenic plant | C1V3 is an artifical Cry1Ab-Vip3A fusion | Colin Berry | 2025-09-04 |
| 748 | | 137756 | C1V3 | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | | | | 1 | 10.1002/ps.8863 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | C1V3 is an artifical Cry1Ab-Vip3A fusion | Colin Berry | 2025-09-04 |
| 749 | | 137757 | C1V3 | No | Not applicable | Lepidoptera | Spodoptera litura | Yes | 69820 | | | | 1 | 10.1002/ps.8863 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | C1V3 is an artifical Cry1Ab-Vip3A fusion | Colin Berry | 2025-09-04 |
| 750 | | 138031 | C1V3 | No | Not applicable | Lepidoptera | Cnaphalocrocis medinalis | Yes | 437488 | | | | 0.669 | 10.1038/s41598-018-34104-4 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | C1V3 is an artifical Cry1Ab-Vip3A fusion | Colin Berry | 2025-09-04 |
| 751 | | 138030 | C1V3 | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | | | | 0.894 | 10.1038/s41598-018-34104-4 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | C1V3 is an artifical Cry1Ab-Vip3A fusion | Colin Berry | 2025-09-04 |
| 752 | | 46869 | CHRD | No | Not applicable | Diptera | Musca domestica | Yes | 7370 | | | | 30% at 1mg/ml | 10.1038/srep43805 | | Not specified | Not specified | Purified protein | Not specified | | Alexander Wall | 2024-05-09 |
| 753 | | 46870 | CpbA | No | Not applicable | Diptera | Musca domestica | Yes | 7370 | | | | 40% at 1mg/ml | 10.1038/srep43805 | | Not specified | Not specified | Purified protein | Not specified | | Alexander Wall | 2024-06-09 |
| 754 | | 46871 | CpbB | No | Not applicable | Diptera | Musca domestica | Yes | 7370 | | | | 12% at 1mg/ml | 10.1038/srep43805 | | Not specified | Not specified | Purified protein | Not specified | | Alexander Wall | 2024-07-09 |
| 755 | | 129620 | Cry10 | No | Not applicable | Hemiptera | Diaphorina citri | Yes | 121845 | | | | 65% mortality | 10.1111/1744-7917.12654 | | | | | | 65% at 5 days | Colin Berry | 2023-12-18 |
| 756 | | 47117 | Cry10Aa | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 239 | ng/ml | | | 10.1128/AEM.00409-09 | | Larvae | 4th instar | Purified crystals | addition to water | | Jakub Baranek | 2024-11-05 |
| 757 | | 138542 | Cry10Aa | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 299.62 | ng/ml | | | 10.3390/toxins12060355 | | Larvae | 2nd instar | Spore crystal mix | Addition to water | | Colin Berry | 2025-09-04 |
| 758 | | 129539 | Cry10Aa | No | Not applicable | Diptera | Simulium spp. | No | 7191 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.jip.2014.07.003 | | Larvae | | Diluted whole cell culture | Addition to water | Mixed Simulium species used, 90% identified as Simulium perflavum. No toxicity at 2500mg/ml | Colin Berry | 2024-06-13 |
| 759 | MNPYQNKNEYEIFNAPSNGFSKSNNYSRYPLANKPNQPLKNTNYKDWLNVCQDNQQYGNNAGNFASSETIVGVSAGIIVV
GTMLGAFAAPVLAAGIISFGTLLPIFWQGSDPANVWQDLLNIGGRPIQEIDKNIINVLTSIVTPIKNQLDKYQEFFDKWE
PARTHANAKAVHDLFTTLEPIIDKDLDMLKNNASYRIPTLPAYAQIATWHLNLLKHAATYYNIWLQNQGINPSTFNSSNY
YQGYLKRKIQEYTDYCIQTYNAGLTMIRTNTNATWNMYNTYRLEMTLTVLDLIAIFPNYDPEKYPIGVKSELIREVYTNV
NSDTFRTITELENGLTRNPTLFTWINQGRFYTRNSRDILDPYDIFSFTGNQMAFTHTNDDRNIIWGAVHGNIISQDTSKV
FPFYRNKPIDKVEIVRHREYSDIIYEMIFFSNSSEVFRYSSNSTIENNYKRTDSYMIPKQTWKNEEYGHTLSYIKTDNYI
FSVVRERRRVAFSWTHTSVDFQNTIDLDNITQIHALKALKVSSDSKIVKGPGHTGGDLVILKDSMDFRVRFLKNVSRQYQ
VRIRYATNAPKTTVFLTGIDTISVELPSTTSRQNPNATDLTYADFGYVTFPRTVPNKTFEGEDTLLMTLYGTPNHSYNIY
IDKIEFIPITQSVLDYTEKQNIEKTQKIVNDLFVN
| 46464 | Cry10Aa1 | No | Not applicable | Diptera | Chironomus tepperi | No | 113505 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.jip.2004.10.004 | | Larvae | 4th Instar | Purified protein | Addition to water | LC50 is >200 mg/ml with <10% mortality at this dose | Colin Berry | 2023-07-28 |
| 760 | | 133581 | Cry10Aa1 T589A, T624S | No | Not applicable | Coleoptera | Anthonomus grandis | Yes | 7044 | 7.12 | µg/ml | | | 10.5376/bt.2012.03.0004 | | Larvae | 1st Instar | Spore crystal mix | Diet incorporation | This is a natural variant of Cry10Aa not yet submitted for naming from strain S1804 | Colin Berry | 2025-01-13 |
| 761 | | 133580 | Cry10Aa1 T589A, T624S | No | Not applicable | Coleoptera | Anthonomus grandis | Yes | 7044 | | | | 60% to 100% | 10.1111/pbi.12694 | | Adults | | Transgenic plant | Transgenic plant | This is a natural variant of Cry10Aa not yet submitted for naming from strain S1804. Different levels of toxicity depending on the different transgenic lines | Colin Berry | 2025-01-13 |
| 762 | | 133579 | Cry10Aa1 T589A, T624S | No | Not applicable | Coleoptera | Anthonomus grandis | Yes | 7044 | | | | 60% to 100% | 10.1111/pbi.12694 | | Larvae | 1st Instar | Transgenic plant | Transgenic plant | This is a natural variant of Cry10Aa not yet submitted for naming from strain S1804. Different levels of toxicity depending on the different transgenic lines | Colin Berry | 2025-01-13 |
| 763 | MNPYQNKNEYEIFNAPSNGFSKSNNYSRYPLANKPNQPLKNTNYKDWLNVCQDNQQYGNNAGNFASSETIVGVSAGIIVV
GTMLGAFAAPVLAAGIISFGTLLPIFWQGSDPANVWQDLLNIGGRPIQEIDKNIINVLTSIVTPIKNQLDKYQEFFDKWE
PARTHANAKAVHDLFTTLEPIIDKDLDMLKNNASYRIPTLPAYAQIATWHLNLLKHAATYYNIWLQNQGINPSTFNSSNY
YQGYLKRKIQEYTDYCIQTYNAGLTMIRTNTNATWNMYNTYRLEMTLTVLDLIAIFPNYDPEKYPIGVKSELIREVYTNV
NSDTFRTITELENGLTRNPTLFTWINQGRFYTRNSRDILDPYDIFSFTGNQMAFTHTNDDRNIIWGAVHGNIISQDTSKV
FPFYRNKPIDKVEIVRHREYSDIIYEMIFFSNSSEVFRYSSNSTIENNYKRTDSYMIPKQTWKNKEYGHTLSYIKTDNYI
FSVVRERRRVAFSWTHTSVDFQNTIDLDNITQIHALKALKVSSDSKIVKGPGHTGGDLVILKDSMDFRVRFLKNVSRQYQ
VRIRYATNAPKTTVFLTGIDTISVELPSTTSRQNPNATDLTYADFGYVTFPRTVPNKTFEGEDTLLMTLYGTPNHSYNIY
IDKIEFIPITQSVLDYTEKQNIEKTQKIVNDLFVN
| 133578 | Cry10Aa3 | No | Not applicable | Coleoptera | Hypothenemus hampei | Yes | 57062 | | | | 85% to 100% | 10.3389/fpls.2021.765292 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | Percent mortality assessed after 10 days | Colin Berry | 2025-01-12 |
| 764 | | 129621 | Cry11 | No | Not applicable | Hemiptera | Diaphorina citri | Yes | 121845 | | | | 60% mortality | 10.1111/1744-7917.12654 | | | | | | 60% at 5 days | Colin Berry | 2023-12-18 |
| 765 | | 47430 | Cry11A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 1350 | ng/ml | | | 10.1603/0022-2585-41.3.435 | | Larvae | 4th instar | Spore crystal mix | addition to water | | Jakub Baranek | 2024-03-20 |
| 766 | | 47288 | Cry11A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 946 | ng/ml | | | 10.1128/AEM.71.1.185-189.2005 | | Larvae | 4th instar | Spore crystal mix | addition to water | Variable LC50 across generations and assays from 88-7330ng/ml | edited CB | 2024-10-29 |
| 767 | | 47015 | Cry11A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 85 | ng/ml | | | 10.1111/j.1365-2958.1994.tb00488.x | | Larvae | 1st instar | Purified crystals | addition to water | | Jakub Baranek | 2024-01-29 |
| 768 | | 46927 | Cry11A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 741 | ng/ml | | | 10.1073/pnas.94.20.10536 | | Larvae | 4th instar | Spore crystal mix | addition to water | | Jakub Baranek | 2024-02-11 |
| 769 | | 47251 | Cry11A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 783 | ng/ml | | | 10.1128/AEM.64.11.4174-4179.1998 | | Larvae | 4th instar | Spore crystal mix | addition to water | | Jakub Baranek | 2024-09-22 |
| 770 | | 47049 | Cry11A | No | Not applicable | Hemiptera | Macrosiphum euphorbiae | Yes | 13131 | | | | 64% mortality at 350 µg/ml | 10.1111/j.1570-7458.1995.tb02003.x | | Adult | Not applicable | Purified protein | Membrane feeding | Mortality observed after 72 hours | Neil Crickmore | 2024-04-03 |
| 771 | | 46250 | Cry11Aa | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 455 | ng/ml | | | 10.1006/jipa.1995.1075 | | Larvae | 3rd instar | Purified crystals | addition to water | | Jakub Baranek | 2022-12-26 |
| 772 | | 46251 | Cry11Aa | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 268 | ng/ml | | | 10.1006/jipa.1995.1075 | | Larvae | 3rd instar | Purified crystals | addition to water | | Jakub Baranek | 2022-12-27 |
| 773 | | 47550 | Cry11Aa | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 1910 | ng/ml | | | 10.1007/s13355-016-0454-z | | Larvae | 3rd instar | Purified protein | addition to water | | Jakub Baranek | 2024-07-18 |
| 774 | | 47218 | Cry11Aa | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 36.5 | ng/ml | | | 10.1128/AEM.59.3.815-821.1993 | | Larvae | 4th instar | Purified crystals | addition to water | LC36.5 - 39.7 ng/ml depending on construct used | Jakub Baranek | 2024-08-20 |
| 775 | | 138135 | Cry11Aa | No | Not applicable | Diptera | Tipula paludosa | No | 52758 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/AEM.01056-06 | | Larvae | 1st instar | Spore crystal mix | Surface contamination | | Colin Berry | 2025-09-04 |
| 776 | | 138629 | Cry11Aa | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 224 | ng/ml | | | 10.3390/toxins6041222 | | Larvae | | Inclusions | Addition to water | 3 day old larvase used. | Colin Berry | 2025-09-04 |
| 777 | | 138543 | Cry11Aa | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | | 10.3390/toxins12060355 | | Larvae | 2nd instar | Spore crystal mix | Addition to water | LC50 not provided as concdentrations estimated to give ~LC30 used. | Colin Berry | 2025-09-04 |
| 778 | | 47125 | Cry11Aa | No | Not applicable | Hemiptera | Acyrthosiphon pisum | Yes | 7029 | | | | 100% at 500 µg/ml | 10.1128/AEM.00686-09 | | Nymph | Not specified | Purified protein | Membrane feeding | mortality was observed after 3 to 6 days of exposure | Ruchir and Suresh | 2024-05-19 |
| 779 | | 129540 | Cry11Aa | No | Not applicable | Diptera | Simulium spp. | Yes | 7191 | 830 | mg/ml | | | 10.1016/j.jip.2014.07.003 | | Larvae | | Diluted whole cell culture | Addition to water | Mixed Simulium species used, 90% identified as Simulium perflavum. | Colin Berry | 2024-06-13 |
| 780 | | 46500 | Cry11Aa | No | Not applicable | Diptera | Anopheles albimanus | Yes | 7167 | | | | 33.3% at 360ng/ml | 10.1016/j.jip.2010.03.007 | | Larvae | 4th Instar | Spore crystal mix | addition to water | Mortality observed after 1 day | Jakub Baranek | 2023-02-09 |
| 781 | | 46249 | Cry11Aa | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 287 | ng/ml | | | 10.1006/jipa.1995.1075 | | Larvae | 3rd instar | Purified crystals | addition to water | | Jakub Baranek | 2022-12-25 |
| 782 | | 46876 | Cry11Aa | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 235.9 | ng/ml | | | 10.1073/pnas.0505494102 | | Larvae | 4th instar | Purified crystals | addition to water | | Jakub Baranek | 2024-12-09 |
| 783 | | 47009 | Cry11Aa | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 20% at 200ng/ml | 10.1111/1462-2920.12263 | | Larvae | 4th instar | Spore crystal mix | addition to water | Mortality observed after 1 day | Jakub Baranek | 2024-01-23 |
| 784 | | 47062 | Cry11Aa | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 224 | ng/ml | | | 10.1111/j.1574-6968.1995.tb07784.x | | Larvae | 3 day old | Purified crystals | addition to water | | Jakub Baranek | 2024-03-17 |
| 785 | | 138840 | Cry11Aa | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 1.14 | µg/ml | | | 10.1128/AEM.00654-07 | | Larvae | 4th instar | Spore crystal mix | Addition to water | | Colin Berry | 2025-09-04 |
| 786 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 46730 | Cry11Aa1 | No | Not applicable | Diptera | Anopheles albimanus | Yes | 7167 | 675.9 | ng/ml | | | 10.1016/s0167-4838(98)00168-x | | Larvae | 1st Instar | Purified protein | Not specified | | Alexander Wall | 2024-04-19 |
| 787 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 137986 | Cry11Aa1 | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7178 | 13.78 | ng/ml | | | 10.1016/j.toxicon.2017.08.025 | | Larvae | 2nd instar | Purified protein | Addition to water | Assay method referenced in text: Zhang et al., 2012 | Colin Berry | 2025-09-04 |
| 788 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 46731 | Cry11Aa1 | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 57.9 | ng/ml | | | 10.1016/s0167-4838(98)00168-x | | Larvae | 1st Instar | Purified protein | Not specified | | Alexander Wall | 2024-04-20 |
| 789 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 46465 | Cry11Aa1 | No | Not applicable | Diptera | Chironomus tepperi | Yes | 113505 | 0.56 | mg/l | | | 10.1016/j.jip.2004.10.004 | | Larvae | 4th Instar | Spore crystal mix | Addition to water | | Alexander Wall | 2023-07-29 |
| 790 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 47225 | Cry11Aa1 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 4.81 | ng/ml | | | 10.1128/aem.61.7.2601-2605.1995 | | Larvae | 2nd Instar | Spore crystal mix | Addition to water | | Alexander Wall | 2024-08-27 |
| 791 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 46729 | Cry11Aa1 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 39.2 | ng/ml | | | 10.1016/s0167-4838(98)00168-x | | Larvae | 1st Instar | Purified protein | Not specified | | Alexander Wall | 2024-04-18 |
| 792 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 47227 | Cry11Aa1 | No | Not applicable | Diptera | Tipula oleracea | Yes | 312236 | 8.8 | ng/ml | | | 10.1128/aem.61.7.2601-2605.1995 | | Larvae | 2nd Instar | Spore crystal mix | Addition to water | | Alexander Wall | 2024-08-29 |
| 793 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 47226 | Cry11Aa1 | No | Not applicable | Lepidoptera | Manduca sexta | No | 7130 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/aem.61.7.2601-2605.1995 | | Larvae | 2nd Instar | Spore crystal mix | Diet incorporation | | Alexander Wall | 2024-08-28 |
| 794 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 138210 | Cry11Aa1 | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 0.086 to 0.688 | µg/ml | | | 10.1128/aem.63.3.1095-1101.1997 | | Larvae | 4th instar | Spore crystal mix | Addition to water | | Colin Berry | 2025-09-04 |
| 795 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 138201 | Cry11Aa1 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 326 | ng/ml | | | 10.1128/aem.61.12.4230-4235.1995 | | Larvae | 3rd instar | | Addition to water | | Colin Berry | 2025-09-04 |
| 796 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 138200 | Cry11Aa1 | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 372.4 | ng/ml | | | 10.1128/aem.61.12.4230-4235.1995 | | Larvae | 4th instar | | Addition to water | | Colin Berry | 2025-09-04 |
| 797 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 138199 | Cry11Aa1 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 121.5 | ng/ml | | | 10.1128/aem.61.12.4230-4235.1995 | | Larvae | 4th instar | | Addition to water | | Colin Berry | 2025-09-04 |
| 798 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 138190 | Cry11Aa1 | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 30 | ng/ml | | | 10.1128/aem.59.11.3928-3930.1993 | | Larvae | 4th instar | Spore crystal mix | Addition to water | | Colin Berry | 2025-09-04 |
| 799 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 138189 | Cry11Aa1 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 12.3 | ng/ml | | | 10.1128/aem.59.11.3928-3930.1993 | | Larvae | 3rd instar | Spore crystal mix | Addition to water | | Colin Berry | 2025-09-04 |
| 800 | MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVET
LINQKLSQDRVNILNAEYRGIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLH
LTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFRNMCNLYVFPFAEAWSLMR
YEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTG
WIGNGRTNNFNFADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNIK
LGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSH
YLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGI
RVQSQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFTTQINP
LLK
| 138188 | Cry11Aa1 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 18.1 | ng/ml | | | 10.1128/aem.59.11.3928-3930.1993 | | Larvae | 4th instar | Spore crystal mix | Addition to water | | Colin Berry | 2025-09-04 |
| 801 | MNYMEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQY
LATAIGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVETLINQKLSQDRVNILNAEYR
GIIEVSDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMC
TLHLTLLKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSL
KDGLTFRNMCNLYVFPFAEAWSLMRYEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYK
LLMGEVNQRLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTGWIGNGRTNNFN
FADNNGNEIMEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQW
FQSTLYGWNIKLGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTL
TYNRIEYDSPTTENIIVGFAPDNTKDFYSKKSHYLSETNDSYVIPALQFAEVSDRSFL
EDTPDQATDGSIKFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGIRVQ
SQNSGNNRMLGSFTANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEW
YLSQLFLVKESAFTTQINPLLK
| 138553 | Cry11Aa6 | No | Not applicable | Diptera | Aedes albopictus | Yes | 7160 | 228 | ng/ml | | | 10.3390/toxins15030211 | | Larvae | 2nd instar | Spore crystal mix | Addition to water | | Colin Berry | 2025-09-04 |
| 802 | | 47252 | Cry11B | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 88.1 | ng/ml | | | 10.1128/AEM.64.11.4174-4179.1998 | | Larvae | 4th instar | Spore crystal mix | addition to water | | Jakub Baranek | 2024-09-23 |
| 803 | | 47431 | Cry11B | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 729 | ng/ml | | | 10.1603/0022-2585-41.3.435 | | Larvae | 4th instar | Spore crystal mix | addition to water | Cry11B resistant | Jakub Baranek | 2024-03-21 |
| 804 | | 47551 | Cry11Ba | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 110 | ng/ml | | | 10.1007/s13355-016-0454-z | | Larvae | 3rd instar | Purified protein | addition to water | | Jakub Baranek | 2024-07-19 |
| 805 | | 138849 | Cry11Ba | No | Not applicable | Diptera | Anopheles gambiae | Yes | 7165 | | | | ~90% | 10.1021/bi801181g | | Larvae | 4th instar | | Addition to water | | Colin Berry | 2025-09-04 |
| 806 | MQNNNFNTTEINNMINFPMYNGRLEPSLAPALIAVAPIAKYLATALAKWAVKQGFAKLKSEIFPGNTPATMDKVRIEVQT
LLDQRLQDDRVKILEGEYKGIIDVSKVFTDYVNQSKFETGTANRLFFDTSNQLISRLPQFEIAGYEGVSISLFTQMCTFH
LGLLKDGILAGSDWGFAPADKDALICQFNRFVNEYNTRLMVLYSKEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWSLLR
YEGTKLENTLSLWNFVGESINNISPNDWKGALYKLLMGAPNQRLNNVKFNYSYFSDTQATIHRENIHGVLPTYNGGPTIT
GWIGNGRFSGLSFPCSNELEITKIKQEITYNDKGGNFNSIVPAATRNEILTATVPTSADPFFKTADINWKYFSPGLYSGW
NIKFDDTVTLKSRVPSIIPSNILKYDDYYIRAVSACPKGVSLAYNHDFLTLTYNKLEYDAPTTQNIIVGFSPDNTKSFYR
SNSHYLSTTDDAYVIPALQFSTVSDRSFLEDTPDQATDGSIKFTDTVLGNEAKYSIRLNTGFNTATRYRLIIRFKAPARL
AAGIRVRSQNSGNNKLLGGIPVEGNSGWIDYITDSFTFDDLGITTSSTNAFFSIDSDGVNASQQWYLSKLILVKESSFTT
QIPLKPYVIVRCPDTFFVSNNSSSTYEQGYNNNYNQNSSSMYDQGYNNSYNPNSGCTCNQDYNNSYNQNSGCTCNQGYNN
NYPK
| 138196 | Cry11Ba1 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 18.8 | ng/ml | | | 10.1128/aem.61.12.4230-4235.1995 | | Larvae | 4th instar | | Addition to water | | Colin Berry | 2025-09-04 |
| 807 | MQNNNFNTTEINNMINFPMYNGRLEPSLAPALIAVAPIAKYLATALAKWAVKQGFAKLKSEIFPGNTPATMDKVRIEVQT
LLDQRLQDDRVKILEGEYKGIIDVSKVFTDYVNQSKFETGTANRLFFDTSNQLISRLPQFEIAGYEGVSISLFTQMCTFH
LGLLKDGILAGSDWGFAPADKDALICQFNRFVNEYNTRLMVLYSKEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWSLLR
YEGTKLENTLSLWNFVGESINNISPNDWKGALYKLLMGAPNQRLNNVKFNYSYFSDTQATIHRENIHGVLPTYNGGPTIT
GWIGNGRFSGLSFPCSNELEITKIKQEITYNDKGGNFNSIVPAATRNEILTATVPTSADPFFKTADINWKYFSPGLYSGW
NIKFDDTVTLKSRVPSIIPSNILKYDDYYIRAVSACPKGVSLAYNHDFLTLTYNKLEYDAPTTQNIIVGFSPDNTKSFYR
SNSHYLSTTDDAYVIPALQFSTVSDRSFLEDTPDQATDGSIKFTDTVLGNEAKYSIRLNTGFNTATRYRLIIRFKAPARL
AAGIRVRSQNSGNNKLLGGIPVEGNSGWIDYITDSFTFDDLGITTSSTNAFFSIDSDGVNASQQWYLSKLILVKESSFTT
QIPLKPYVIVRCPDTFFVSNNSSSTYEQGYNNNYNQNSSSMYDQGYNNSYNPNSGCTCNQDYNNSYNQNSGCTCNQGYNN
NYPK
| 138797 | Cry11Ba1 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 2.2 | ng/ml | | | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 808 | MQNNNFNTTEINNMINFPMYNGRLEPSLAPALIAVAPIAKYLATALAKWAVKQGFAKLKSEIFPGNTPATMDKVRIEVQT
LLDQRLQDDRVKILEGEYKGIIDVSKVFTDYVNQSKFETGTANRLFFDTSNQLISRLPQFEIAGYEGVSISLFTQMCTFH
LGLLKDGILAGSDWGFAPADKDALICQFNRFVNEYNTRLMVLYSKEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWSLLR
YEGTKLENTLSLWNFVGESINNISPNDWKGALYKLLMGAPNQRLNNVKFNYSYFSDTQATIHRENIHGVLPTYNGGPTIT
GWIGNGRFSGLSFPCSNELEITKIKQEITYNDKGGNFNSIVPAATRNEILTATVPTSADPFFKTADINWKYFSPGLYSGW
NIKFDDTVTLKSRVPSIIPSNILKYDDYYIRAVSACPKGVSLAYNHDFLTLTYNKLEYDAPTTQNIIVGFSPDNTKSFYR
SNSHYLSTTDDAYVIPALQFSTVSDRSFLEDTPDQATDGSIKFTDTVLGNEAKYSIRLNTGFNTATRYRLIIRFKAPARL
AAGIRVRSQNSGNNKLLGGIPVEGNSGWIDYITDSFTFDDLGITTSSTNAFFSIDSDGVNASQQWYLSKLILVKESSFTT
QIPLKPYVIVRCPDTFFVSNNSSSTYEQGYNNNYNQNSSSMYDQGYNNSYNPNSGCTCNQDYNNSYNQNSGCTCNQGYNN
NYPK
| 138197 | Cry11Ba1 | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 9.6 | ng/ml | | | 10.1128/aem.61.12.4230-4235.1995 | | Larvae | 4th instar | | Addition to water | | Colin Berry | 2025-09-04 |
| 809 | MQNNNFNTTEINNMINFPMYNGRLEPSLAPALIAVAPIAKYLATALAKWAVKQGFAKLKSEIFPGNTPATMDKVRIEVQT
LLDQRLQDDRVKILEGEYKGIIDVSKVFTDYVNQSKFETGTANRLFFDTSNQLISRLPQFEIAGYEGVSISLFTQMCTFH
LGLLKDGILAGSDWGFAPADKDALICQFNRFVNEYNTRLMVLYSKEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWSLLR
YEGTKLENTLSLWNFVGESINNISPNDWKGALYKLLMGAPNQRLNNVKFNYSYFSDTQATIHRENIHGVLPTYNGGPTIT
GWIGNGRFSGLSFPCSNELEITKIKQEITYNDKGGNFNSIVPAATRNEILTATVPTSADPFFKTADINWKYFSPGLYSGW
NIKFDDTVTLKSRVPSIIPSNILKYDDYYIRAVSACPKGVSLAYNHDFLTLTYNKLEYDAPTTQNIIVGFSPDNTKSFYR
SNSHYLSTTDDAYVIPALQFSTVSDRSFLEDTPDQATDGSIKFTDTVLGNEAKYSIRLNTGFNTATRYRLIIRFKAPARL
AAGIRVRSQNSGNNKLLGGIPVEGNSGWIDYITDSFTFDDLGITTSSTNAFFSIDSDGVNASQQWYLSKLILVKESSFTT
QIPLKPYVIVRCPDTFFVSNNSSSTYEQGYNNNYNQNSSSMYDQGYNNSYNPNSGCTCNQDYNNSYNQNSGCTCNQGYNN
NYPK
| 138198 | Cry11Ba1 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 54.5 | ng/ml | | | 10.1128/aem.61.12.4230-4235.1995 | | Larvae | 3rd instar | | Addition to water | | Colin Berry | 2025-09-04 |
| 810 | MQNNNFNTTEINNMINFPMYNGRLEPSLAPALIAVAPIAKYLATALAKWAVKQGFAKLKSEIFPGNTPATMDKVRIEVQT
LLDQRLQDDRVKILEGEYKGIIDVSKVFTDYVNQSKFETGTANRLFFDTSNQLISRLPQFEIAGYEGVSISLFTQMCTFH
LGLLKDGILAGSDWGFAPADKDALICQFNRFVNEYNTRLMVLYSKEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWSLLR
YEGTKLENTLSLWNFVGESINNISPNDWKGALYKLLMGAPNQRLNNVKFNYSYFSDTQATIHRENIHGVLPTYNGGPTIT
GWIGNGRFSGLSFPCSNELEITKIKQEITYNDKGGNFNSIVPAATRNEILTATVPTSADPFFKTADINWKYFSPGLYSGW
NIKFDDTVTLKSRVPSIIPSNILKYDDYYIRAVSACPKGVSLAYNHDFLTLTYNKLEYDAPTTQNIIVGFSPDNTKSFYR
SNSHYLSTTDDAYVIPALQFSTVSDRSFLEDTPDQATDGSIKFTDTVLGNEAKYSIRLNTGFNTATRYRLIIRFKAPARL
AAGIRVRSQNSGNNKLLGGIPVEGNSGWIDYITDSFTFDDLGITTSSTNAFFSIDSDGVNASQQWYLSKLILVKESSFTT
QIPLKPYVIVRCPDTFFVSNNSSSTYEQGYNNNYNQNSSSMYDQGYNNSYNPNSGCTCNQDYNNSYNQNSGCTCNQGYNN
NYPK
| 138725 | Cry11Ba1 | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 3.3 | ng/ml | | | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 811 | MQNNNFNTTEINNMINFPMYNGRLEPSLAPALIAVAPIAKYLATALAKWAVKQGFAKLKSEIFPGNTPATMDKVRIEVQT
LLDQRLQDDRVKILEGEYKGIIDVSKVFTDYVNQSKFETGTANRLFFDTSNQLISRLPQFEIAGYEGVSISLFTQMCTFH
LGLLKDGILAGSDWGFAPADKDALICQFNRFVNEYNTRLMVLYSKEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWSLLR
YEGTKLENTLSLWNFVGESINNISPNDWKGALYKLLMGAPNQRLNNVKFNYSYFSDTQATIHRENIHGVLPTYNGGPTIT
GWIGNGRFSGLSFPCSNELEITKIKQEITYNDKGGNFNSIVPAATRNEILTATVPTSADPFFKTADINWKYFSPGLYSGW
NIKFDDTVTLKSRVPSIIPSNILKYDDYYIRAVSACPKGVSLAYNHDFLTLTYNKLEYDAPTTQNIIVGFSPDNTKSFYR
SNSHYLSTTDDAYVIPALQFSTVSDRSFLEDTPDQATDGSIKFTDTVLGNEAKYSIRLNTGFNTATRYRLIIRFKAPARL
AAGIRVRSQNSGNNKLLGGIPVEGNSGWIDYITDSFTFDDLGITTSSTNAFFSIDSDGVNASQQWYLSKLILVKESSFTT
QIPLKPYVIVRCPDTFFVSNNSSSTYEQGYNNNYNQNSSSMYDQGYNNSYNPNSGCTCNQDYNNSYNQNSGCTCNQGYNN
NYPK
| 138761 | Cry11Ba1 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 7.86 | ng/ml | | | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 812 | | 138787 | Cry11Ba1 L1-E304A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.75 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 813 | | 138751 | Cry11Ba1 L1-E304A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 814 | | 138823 | Cry11Ba1 L1-E304A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 0.92 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 815 | | 138826 | Cry11Ba1 L1-G308A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 816 | | 138790 | Cry11Ba1 L1-G308A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.75 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 817 | | 138754 | Cry11Ba1 L1-G308A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 818 | | 138753 | Cry11Ba1 L1-H307A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 819 | | 138825 | Cry11Ba1 L1-H307A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 820 | | 138789 | Cry11Ba1 L1-H307A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.87 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 821 | | 138752 | Cry11Ba1 L1-I306A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.12 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 822 | | 138824 | Cry11Ba1 L1-I306A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 823 | | 138788 | Cry11Ba1 L1-I306A | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 824 | | 138804 | Cry11Ba1 L1-I306A/H307A/G308A 3 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 825 | | 138768 | Cry11Ba1 L1-I306A/H307A/G308A 3 | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | Only 3% toxicity recorded | Colin Berry | 2025-09-04 |
| 826 | | 138732 | Cry11Ba1 L1-I306A/H307A/G308A 3 | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.86 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 827 | | 138786 | Cry11Ba1 L1-R303A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.88 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 828 | | 138822 | Cry11Ba1 L1-R303A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 829 | | 138750 | Cry11Ba1 L1-R303A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.98 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 830 | | 138731 | Cry11Ba1 L1-R303A/E304A/N305A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 9249 | ng/ml | | | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 831 | | 138803 | Cry11Ba1 L1-R303A/E304A/N305A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 3128 | | | | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 832 | | 138767 | Cry11Ba1 L1-R303A/E304A/N305A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 2176 | | | | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 833 | | 138805 | Cry11Ba1 L1-V309A/L310A/P311A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 834 | | 138733 | Cry11Ba1 L1-V309A/L310A/P311A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.98 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 835 | | 138769 | Cry11Ba1 L1-V309A/L310A/P311A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.92 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 836 | | 138771 | Cry11Ba1 L2-P394A/G395A/L396A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.72 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 837 | | 138807 | Cry11Ba1 L2-P394A/G395A/L396A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 838 | | 138735 | Cry11Ba1 L2-P394A/G395A/L396A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 839 | | 138734 | Cry11Ba1 L2-Y291A/F392A/S393A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 840 | | 138770 | Cry11Ba1 L2-Y291A/F392A/S393A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.97 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 841 | | 138806 | Cry11Ba1 L2-Y291A/F392A/S393A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 842 | | 138739 | Cry11Ba1 L3-A460A/P461A/T462A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.95 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 843 | | 138811 | Cry11Ba1 L3-A460A/P461A/T462A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 844 | | 138775 | Cry11Ba1 L3-A460A/P461A/T462A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.97 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 845 | | 138738 | Cry11Ba1 L3-E457A/Y458A/D459A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 846 | | 138810 | Cry11Ba1 L3-E457A/Y458A/D459A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 847 | | 138774 | Cry11Ba1 L3-E457A/Y458A/D459A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.87 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 848 | | 138831 | Cry11Ba1 L3-K455A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 849 | | 138795 | Cry11Ba1 L3-K455A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.83 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 850 | | 138759 | Cry11Ba1 L3-K455A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 851 | | 138827 | Cry11Ba1 L3-L451A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 0.97 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 852 | | 138755 | Cry11Ba1 L3-L451A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.8 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 853 | | 138791 | Cry11Ba1 L3-L451A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.9 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 854 | | 138808 | Cry11Ba1 L3-L451A/T452A/Y453A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 855 | | 138736 | Cry11Ba1 L3-L451A/T452A/Y453A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.23 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 856 | | 138772 | Cry11Ba1 L3-L451A/T452A/Y453A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.27 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 857 | | 138832 | Cry11Ba1 L3-L456A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 858 | | 138796 | Cry11Ba1 L3-L456A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.87 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 859 | | 138760 | Cry11Ba1 L3-L456A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.92 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 860 | | 138758 | Cry11Ba1 L3-N454A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.92 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 861 | | 138830 | Cry11Ba1 L3-N454A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 862 | | 138794 | Cry11Ba1 L3-N454A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.87 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 863 | | 138773 | Cry11Ba1 L3-N454A/K455A/L456A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.23 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 864 | | 138737 | Cry11Ba1 L3-N454A/K455A/L456A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.33 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 865 | | 138809 | Cry11Ba1 L3-N454A/K455A/L456A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 0.98 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 866 | | 138828 | Cry11Ba1 L3-T452A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 0.98 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 867 | | 138792 | Cry11Ba1 L3-T452A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.92 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 868 | | 138756 | Cry11Ba1 L3-T452A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.92 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 869 | | 138740 | Cry11Ba1 L3-T463A/Q464A/N465A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.93 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 870 | | 138776 | Cry11Ba1 L3-T463A/Q464A/N465A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.82 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 871 | | 138812 | Cry11Ba1 L3-T463A/Q464A/N465A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 872 | | 138793 | Cry11Ba1 L3-Y453A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.75 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 873 | | 138829 | Cry11Ba1 L3-Y453A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 874 | | 138757 | Cry11Ba1 L3-Y453A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.95 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 875 | | 138743 | Cry11Ba1 a8-E258A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 876 | | 138779 | Cry11Ba1 a8-E258A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.78 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 877 | | 138815 | Cry11Ba1 a8-E258A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 878 | | 138742 | Cry11Ba1 a8-G257A | No | Not applicable | Diptera | Culex quinquefasciatus | No | 7176 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | Only 3% toxicity recorded | Colin Berry | 2025-09-04 |
| 879 | | 138778 | Cry11Ba1 a8-G257A | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | Only 2% toxicity recorded | Colin Berry | 2025-09-04 |
| 880 | | 138814 | Cry11Ba1 a8-G257A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 0.33 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 881 | | 138821 | Cry11Ba1 a8-G270A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 0.98 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 882 | | 138749 | Cry11Ba1 a8-G270A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 883 | | 138785 | Cry11Ba1 a8-G270A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.83 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 884 | | 138817 | Cry11Ba1 a8-I263A | No | Not applicable | Diptera | Anopheles stephensi | No | 30069 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 885 | | 138781 | Cry11Ba1 a8-I263A | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 886 | | 138745 | Cry11Ba1 a8-I263A | No | Not applicable | Diptera | Culex quinquefasciatus | No | 7176 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | Only 6% toxicity recorded | Colin Berry | 2025-09-04 |
| 887 | | 138748 | Cry11Ba1 a8-K269A | No | Not applicable | Diptera | Culex quinquefasciatus | No | 7176 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | Only 8% toxicity recorded | Colin Berry | 2025-09-04 |
| 888 | | 138820 | Cry11Ba1 a8-K269A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 889 | | 138784 | Cry11Ba1 a8-K269A | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | Only 5% toxicity recorded | Colin Berry | 2025-09-04 |
| 890 | | 138744 | Cry11Ba1 a8-N262A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.95 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 891 | | 138816 | Cry11Ba1 a8-N262A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 892 | | 138780 | Cry11Ba1 a8-N262A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.9 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 893 | | 138800 | Cry11Ba1 a8-N262A/I263A/S264 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 894 | | 138728 | Cry11Ba1 a8-N262A/I263A/S264 | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.72 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 895 | | 138764 | Cry11Ba1 a8-N262A/I263A/S264 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.27 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 896 | | 138729 | Cry11Ba1 a8-P265A/N266A/D267A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.98 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 897 | | 138801 | Cry11Ba1 a8-P265A/N266A/D267A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 898 | | 138765 | Cry11Ba1 a8-P265A/N266A/D267A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.82 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 899 | | 138763 | Cry11Ba1 a8-S259A/I260A/N261A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.9 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 900 | | 138727 | Cry11Ba1 a8-S259A/I260A/N261A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.95 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 901 | | 138799 | Cry11Ba1 a8-S259A/I260A/N261A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 902 | | 138782 | Cry11Ba1 a8-S264A | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 903 | | 138746 | Cry11Ba1 a8-S264A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.38 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 904 | | 138818 | Cry11Ba1 a8-S264A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 905 | | 138813 | Cry11Ba1 a8-V256A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 1 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 906 | | 138741 | Cry11Ba1 a8-V256A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 907 | | 138777 | Cry11Ba1 a8-V256A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.83 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 908 | | 138798 | Cry11Ba1 a8-V256A/G257A/E258A | No | Not applicable | Diptera | Anopheles stephensi | No | 30069 | N/A, not toxic | N/A, not toxic | | 0.03 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | Only 3% toxicity recorded | Colin Berry | 2025-09-04 |
| 909 | | 138762 | Cry11Ba1 a8-V256A/G257A/E258A | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 910 | | 138726 | Cry11Ba1 a8-V256A/G257A/E258A | No | Not applicable | Diptera | Culex quinquefasciatus | No | 7176 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 911 | | 138747 | Cry11Ba1 a8-W268A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | 0.96 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 912 | | 138783 | Cry11Ba1 a8-W268A | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 0.88 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 913 | | 138819 | Cry11Ba1 a8-W268A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 0.98 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 914 | | 138766 | Cry11Ba1 a8-W268A/K269A/G270A | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 915 | | 138802 | Cry11Ba1 a8-W268A/K269A/G270A | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | | | | 0.17 | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | | Colin Berry | 2025-09-04 |
| 916 | | 138730 | Cry11Ba1 a8-W268A/K269A/G270A | No | Not applicable | Diptera | Culex quinquefasciatus | No | 7176 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.febslet.2009.05.020 | | Larvae | 4th instar | Whole cells | Addition to water | Only 6% toxicity recorded | Colin Berry | 2025-09-04 |
| 917 | | 46944 | Cry11Bb | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 846 | ng/ml | | | 10.1078/072320203770865783 | | Larvae | 4th instar | Purified crystals | addition to water | | Jakub Baranek | 2024-11-19 |
| 918 | MENNSFNVLANNNMSSFPLFNSKIEPSIAPALIAVAPIAKYLATALAKWALKQGFAKLKSEIFPGNETATMEKVRLEVQT
ILNQTLQTDRVATLKAEYEGFIHLGKVFTDYVSQSTFTPATAKTHFLNMSNLLIQRLPQFEIAGYEGVSISLFTQMCTLH
LGLLKDGILAGSDWGFTPEDKDSLICQFNRYVNEYNTRMMGLYSIEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWYLLR
YEGTKLENTLSLWNFVGEDIGGILHNDWKGALYKLLMGATNQRLANVRFNYSYFSDTQGTIHRENILGAHPTYNGEQTPT
GWIGNGRLGRFSAPYSNELEITKVEQEITYNNKGDHSNSIVPANTRNEILTATVPITADPFFKTADINWRYFSQGLYYGW
NIKFDDRVILNSRVPGGIPSNRLEYDGYYIRAVSACPRNVPLSYNHNYLTLTYNRLEYDAPTTQNIIVGFSPNNTKSFYA
RNSHYLSATNDAYVIPALQFATVSDRSFLEDTPDQATDGSIKFTETVLGNEAKYSIRLNTGFNTATRYRLVIRFKATARL
AAGIRVRSQNSGNNRLLGGIPVEGNSGWVDYITDSFTFNDLGITTASTNAFFSIDSDGVNASQQWYLSKLILVKDFVNNS
GFRNQVPLAPYVIARCPNTFFVSNNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQ
GYNDNYNQNTSSGYEQGYNDNYNQNTSSGV
| 46732 | Cry11Bb1 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 17.9 | ng/ml | | | 10.1016/S0167-4838(98)00168-X | | Larvae | 2nd Instar | Purified protein | Not specified | Title of this paper misdescribes toxin as Cry11Bb11 | Alexander Wall | 2024-04-21 |
| 919 | MENNSFNVLANNNMSSFPLFNSKIEPSIAPALIAVAPIAKYLATALAKWALKQGFAKLKSEIFPGNETATMEKVRLEVQT
ILNQTLQTDRVATLKAEYEGFIHLGKVFTDYVSQSTFTPATAKTHFLNMSNLLIQRLPQFEIAGYEGVSISLFTQMCTLH
LGLLKDGILAGSDWGFTPEDKDSLICQFNRYVNEYNTRMMGLYSIEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWYLLR
YEGTKLENTLSLWNFVGEDIGGILHNDWKGALYKLLMGATNQRLANVRFNYSYFSDTQGTIHRENILGAHPTYNGEQTPT
GWIGNGRLGRFSAPYSNELEITKVEQEITYNNKGDHSNSIVPANTRNEILTATVPITADPFFKTADINWRYFSQGLYYGW
NIKFDDRVILNSRVPGGIPSNRLEYDGYYIRAVSACPRNVPLSYNHNYLTLTYNRLEYDAPTTQNIIVGFSPNNTKSFYA
RNSHYLSATNDAYVIPALQFATVSDRSFLEDTPDQATDGSIKFTETVLGNEAKYSIRLNTGFNTATRYRLVIRFKATARL
AAGIRVRSQNSGNNRLLGGIPVEGNSGWVDYITDSFTFNDLGITTASTNAFFSIDSDGVNASQQWYLSKLILVKDFVNNS
GFRNQVPLAPYVIARCPNTFFVSNNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQ
GYNDNYNQNTSSGYEQGYNDNYNQNTSSGV
| 46946 | Cry11Bb1 | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 44 | ng/ml | | | 10.1078/072320203770865783 | | Larvae | 4th instar | Purified protein | addition to water | | Alexander Wall | 2024-11-21 |
| 920 | MENNSFNVLANNNMSSFPLFNSKIEPSIAPALIAVAPIAKYLATALAKWALKQGFAKLKSEIFPGNETATMEKVRLEVQT
ILNQTLQTDRVATLKAEYEGFIHLGKVFTDYVSQSTFTPATAKTHFLNMSNLLIQRLPQFEIAGYEGVSISLFTQMCTLH
LGLLKDGILAGSDWGFTPEDKDSLICQFNRYVNEYNTRMMGLYSIEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWYLLR
YEGTKLENTLSLWNFVGEDIGGILHNDWKGALYKLLMGATNQRLANVRFNYSYFSDTQGTIHRENILGAHPTYNGEQTPT
GWIGNGRLGRFSAPYSNELEITKVEQEITYNNKGDHSNSIVPANTRNEILTATVPITADPFFKTADINWRYFSQGLYYGW
NIKFDDRVILNSRVPGGIPSNRLEYDGYYIRAVSACPRNVPLSYNHNYLTLTYNRLEYDAPTTQNIIVGFSPNNTKSFYA
RNSHYLSATNDAYVIPALQFATVSDRSFLEDTPDQATDGSIKFTETVLGNEAKYSIRLNTGFNTATRYRLVIRFKATARL
AAGIRVRSQNSGNNRLLGGIPVEGNSGWVDYITDSFTFNDLGITTASTNAFFSIDSDGVNASQQWYLSKLILVKDFVNNS
GFRNQVPLAPYVIARCPNTFFVSNNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQ
GYNDNYNQNTSSGYEQGYNDNYNQNTSSGV
| 46734 | Cry11Bb1 | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 34.1 | ng/ml | | | 10.1016/S0167-4838(98)00168-X | | Larvae | 3rd Instar | Purified protein | Not specified | Title of this paper misdescribes toxin as Cry11Bb11 | Alexander Wall | 2024-04-23 |
| 921 | MENNSFNVLANNNMSSFPLFNSKIEPSIAPALIAVAPIAKYLATALAKWALKQGFAKLKSEIFPGNETATMEKVRLEVQT
ILNQTLQTDRVATLKAEYEGFIHLGKVFTDYVSQSTFTPATAKTHFLNMSNLLIQRLPQFEIAGYEGVSISLFTQMCTLH
LGLLKDGILAGSDWGFTPEDKDSLICQFNRYVNEYNTRMMGLYSIEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWYLLR
YEGTKLENTLSLWNFVGEDIGGILHNDWKGALYKLLMGATNQRLANVRFNYSYFSDTQGTIHRENILGAHPTYNGEQTPT
GWIGNGRLGRFSAPYSNELEITKVEQEITYNNKGDHSNSIVPANTRNEILTATVPITADPFFKTADINWRYFSQGLYYGW
NIKFDDRVILNSRVPGGIPSNRLEYDGYYIRAVSACPRNVPLSYNHNYLTLTYNRLEYDAPTTQNIIVGFSPNNTKSFYA
RNSHYLSATNDAYVIPALQFATVSDRSFLEDTPDQATDGSIKFTETVLGNEAKYSIRLNTGFNTATRYRLVIRFKATARL
AAGIRVRSQNSGNNRLLGGIPVEGNSGWVDYITDSFTFNDLGITTASTNAFFSIDSDGVNASQQWYLSKLILVKDFVNNS
GFRNQVPLAPYVIARCPNTFFVSNNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQ
GYNDNYNQNTSSGYEQGYNDNYNQNTSSGV
| 46733 | Cry11Bb1 | No | Not applicable | Diptera | Anopheles albimanus | Yes | 7167 | 166.3 | ng/ml | | | 10.1016/S0167-4838(98)00168-X | | Larvae | 1st Instar | Purified protein | Not specified | Title of this paper misdescribes toxin as Cry11Bb11 | Alexander Wall | 2024-04-22 |
| 922 | MENNSFNVLANNNMSSFPLFNSKIEPSIAPALIAVAPIAKYLATALAKWALKQGFAKLKSEIFPGNETATMEKVRLEVQT
ILNQTLQTDRVATLKAEYEGFIHLGKVFTDYVSQSTFTPATAKTHFLNMSNLLIQRLPQFEIAGYEGVSISLFTQMCTLH
LGLLKDGILAGSDWGFTPEDKDSLICQFNRYVNEYNTRMMGLYSIEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWYLLR
YEGTKLENTLSLWNFVGEDIGGILHNDWKGALYKLLMGATNQRLANVRFNYSYFSDTQGTIHRENILGAHPTYNGEQTPT
GWIGNGRLGRFSAPYSNELEITKVEQEITYNNKGDHSNSIVPANTRNEILTATVPITADPFFKTADINWRYFSQGLYYGW
NIKFDDRVILNSRVPGGIPSNRLEYDGYYIRAVSACPRNVPLSYNHNYLTLTYNRLEYDAPTTQNIIVGFSPNNTKSFYA
RNSHYLSATNDAYVIPALQFATVSDRSFLEDTPDQATDGSIKFTETVLGNEAKYSIRLNTGFNTATRYRLVIRFKATARL
AAGIRVRSQNSGNNRLLGGIPVEGNSGWVDYITDSFTFNDLGITTASTNAFFSIDSDGVNASQQWYLSKLILVKDFVNNS
GFRNQVPLAPYVIARCPNTFFVSNNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQ
GYNDNYNQNTSSGYEQGYNDNYNQNTSSGV
| 46945 | Cry11Bb1 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 67 | ng/ml | | | 10.1078/072320203770865783 | | Larvae | 3rd Instar | Purified protein | addition to water | | Alexander Wall | 2024-11-20 |
| 923 | MENNSFNVLANNNMSSFPLFNSKIEPSIAPALIAVAPIAKYLATALAKWALKQGFAKLKSEIFPGNTPATMEKVRLEVQT
LLNQTLQADRVAILNAEYQGFINLGKIFTDYVSQSTFTPATAKTHFLSMSNQLIQRLPQFEIAGYEGVSISLFTQMCTLH
LGLLKDGILAGSDWGFTPEDKDSLICQFNRYVNEYNTRMMGLYSIEFGRLLAKNLNEALNFRNMCSLYVFPFSEAWYLLR
YEGTKLENTLSLWNFVGEDIGGILHNDWKGALYKLLMGATNQRLANVRFNYSYFSDTQGTIHRENILGAHPTYNGEQTPT
GWIGNGRLGRFSAPYSNELEITKVEQEITYNNKGDHSNSIVPANTRNEILTATVPITADPFFKTADINWRYFSQGLYYGW
NIKFDDKVILNSRVPGGIPSNRLEYDGYYIRAVSACPRNVPLSYNHNYLTLTYNRLEYDAPTTQNIIVGFSPNNTKSFYA
RNSHYLSATDDAYVIPALQFATVSDRSFLEDTPDQATDGSIKFTETVLGNEAKYSIRLNTGFNTATRYRLVIRFKAPARL
AAGIRVRSQNSGNNRLLGGIPVEGNSGWVDYITDSFTFNDLGITTASTNAFFSIDSDGVNASQQWYLSKLILVKDFVNNS
GFRNQVPLAPYVITRCPNTFFVSNNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQ
GYNDNYNQNTSSEYEQGYNDNYNQNTSSGYEQGYNDNYNQNTSSGYEQGYIDNYRPNTECKCGRRHNNYDHK
| 138892 | Cry11Bb2 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | | 10.1159/000329824 | | Larvae | 3rd instar | | Addition to water | | Colin Berry | 2025-09-04 |
| 924 | MATLNEVYPVNYNVLSSDAFQQLDTTGFKSKYDEMIKAFEKKWKKGAKGKDLLDVAWTYITTGEIDPLNVIKGVLSVLTL
IPEVGTVASAASTIVSFIWPKIFGDKPNAKNIFEELKPQIEALIQQDITNYQDAINQKKFDSLQKTINLYTVAIDNNDYV
TAKTQLENLNSILTSDISIFIPEGYETGGLPYYAMVANAHILLLRDAIVNAEKLGFSDKEVDTHKKYIKMTIHNHTEAVI
KAFLNGLDKFKSLDVNSYNKKANYIKGMTEMVLDLVALWPTFDPDHYQKEVEIEFTRTISSPIYQPVPKNMQNTSSSIVP
SDLFHYQGDLVKLEFSTRTDNDGLAKIFTGIRNTFYKSPNTHETYHVDFSYNTQSSGNISRGSSNPIPIDLNNPIISTCI
RNSFYKAIAGSSVLVNFKDGTQGYAFAQAPTGGAWDHSFIESDGAPEGHKLNYIYTSPGDTLRDFINVYTLISTPTINEL
STEKIKGFPAEKGYIKNQGIMKYYGKPEYINGAQPVNLENQQTLIFEFHASKTAQYTIRIRYASTQGTKGYFRLDNQELQ
TLNIPTSHNGYVTGNIGENYDLYTIGSYTITEGNHTLQIQHNDKNGMVLDRIEFVPKDSLQDSPQDSPPEVHESTIIFDK
SSPTIWSSNKHSYSHIHLEGSYTSQGSYPHNLLINLFHPTDPNRNHTIHVNNGDMNVDYGKDSVADGLNFNKITATIPSD
AWYSGTITSMHLFNDNNFKTITPKFELSNELENITTQVNALFASSAQDTLASNVSDYWIEQVVMKVDALSDEVFGKEKKA
LRKLVNQAKRLSKIRNLLIGGNFDNLVAWYMGKDVVKESDHELFKSDHVLLPPPTFHPSYIFQKVEESKLKPNTRYTISG
FIAHGEDVELVVSRYGQEIQKVMQVPYEEALPLTSESNSSCCVPNLNINETLADPHFFSYSIDVGSLEMEANPGIEFGLR
IVKPTGMARVSNLEIREDRPLTAKEIRQVQRAARDWKQNYEQERTEITAIIQPVLNQINALYENEDWNGSIRSNVSYHDL
EQIMLPTLLKTEEINCNYDHPAFLLKVYHWFMTDRIGEHGTILARFQEALDRAYTQLESRNLLHNGHFTTDTANWTIEGD
AHHTILEDGRRVLRLPDWSSNATQTIEIEDFDLDQEYQLLIHAKGKGSITLQHGEENEYVETHTHHTNDFITSQNIPFTF
KGNQIEVHITSEDGEFLIDHITVIEVSKTDTNTNIIENSPINTSMNSNVRVDIPRSL
| 46661 | Cry12Aa1 | No | Not applicable | Rhabditida | Bursaphelenchus xylophilus | Yes | 6326 | 58.88 | µg/ml | | | 10.1016/j.jip.2022.107726 | | | | Purified protein | Addition to water | 4th stage juveniles assayed. | Colin Berry | 2024-10-02 |
| 925 | MATLNEVYPVNYNVLSSDAFQQLDTTGFKSKYDEMIKAFEKKWKKGAKGKDLLDVAWTYITTGEIDPLNVIKGVLSVLTL
IPEVGTVASAASTIVSFIWPKIFGDKPNAKNIFEELKPQIEALIQQDITNYQDAINQKKFDSLQKTINLYTVAIDNNDYV
TAKTQLENLNSILTSDISIFIPEGYETGGLPYYAMVANAHILLLRDAIVNAEKLGFSDKEVDTHKKYIKMTIHNHTEAVI
KAFLNGLDKFKSLDVNSYNKKANYIKGMTEMVLDLVALWPTFDPDHYQKEVEIEFTRTISSPIYQPVPKNMQNTSSSIVP
SDLFHYQGDLVKLEFSTRTDNDGLAKIFTGIRNTFYKSPNTHETYHVDFSYNTQSSGNISRGSSNPIPIDLNNPIISTCI
RNSFYKAIAGSSVLVNFKDGTQGYAFAQAPTGGAWDHSFIESDGAPEGHKLNYIYTSPGDTLRDFINVYTLISTPTINEL
STEKIKGFPAEKGYIKNQGIMKYYGKPEYINGAQPVNLENQQTLIFEFHASKTAQYTIRIRYASTQGTKGYFRLDNQELQ
TLNIPTSHNGYVTGNIGENYDLYTIGSYTITEGNHTLQIQHNDKNGMVLDRIEFVPKDSLQDSPQDSPPEVHESTIIFDK
SSPTIWSSNKHSYSHIHLEGSYTSQGSYPHNLLINLFHPTDPNRNHTIHVNNGDMNVDYGKDSVADGLNFNKITATIPSD
AWYSGTITSMHLFNDNNFKTITPKFELSNELENITTQVNALFASSAQDTLASNVSDYWIEQVVMKVDALSDEVFGKEKKA
LRKLVNQAKRLSKIRNLLIGGNFDNLVAWYMGKDVVKESDHELFKSDHVLLPPPTFHPSYIFQKVEESKLKPNTRYTISG
FIAHGEDVELVVSRYGQEIQKVMQVPYEEALPLTSESNSSCCVPNLNINETLADPHFFSYSIDVGSLEMEANPGIEFGLR
IVKPTGMARVSNLEIREDRPLTAKEIRQVQRAARDWKQNYEQERTEITAIIQPVLNQINALYENEDWNGSIRSNVSYHDL
EQIMLPTLLKTEEINCNYDHPAFLLKVYHWFMTDRIGEHGTILARFQEALDRAYTQLESRNLLHNGHFTTDTANWTIEGD
AHHTILEDGRRVLRLPDWSSNATQTIEIEDFDLDQEYQLLIHAKGKGSITLQHGEENEYVETHTHHTNDFITSQNIPFTF
KGNQIEVHITSEDGEFLIDHITVIEVSKTDTNTNIIENSPINTSMNSNVRVDIPRSL
| 46900 | Cry12Aa1 | No | Not applicable | Rhabditida | Pristionchus pacificus | No | 54126 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-06-10 |
| 926 | MATLNEVYPVNYNVLSSDAFQQLDTTGFKSKYDEMIKAFEKKWKKGAKGKDLLDVAWTYITTGEIDPLNVIKGVLSVLTL
IPEVGTVASAASTIVSFIWPKIFGDKPNAKNIFEELKPQIEALIQQDITNYQDAINQKKFDSLQKTINLYTVAIDNNDYV
TAKTQLENLNSILTSDISIFIPEGYETGGLPYYAMVANAHILLLRDAIVNAEKLGFSDKEVDTHKKYIKMTIHNHTEAVI
KAFLNGLDKFKSLDVNSYNKKANYIKGMTEMVLDLVALWPTFDPDHYQKEVEIEFTRTISSPIYQPVPKNMQNTSSSIVP
SDLFHYQGDLVKLEFSTRTDNDGLAKIFTGIRNTFYKSPNTHETYHVDFSYNTQSSGNISRGSSNPIPIDLNNPIISTCI
RNSFYKAIAGSSVLVNFKDGTQGYAFAQAPTGGAWDHSFIESDGAPEGHKLNYIYTSPGDTLRDFINVYTLISTPTINEL
STEKIKGFPAEKGYIKNQGIMKYYGKPEYINGAQPVNLENQQTLIFEFHASKTAQYTIRIRYASTQGTKGYFRLDNQELQ
TLNIPTSHNGYVTGNIGENYDLYTIGSYTITEGNHTLQIQHNDKNGMVLDRIEFVPKDSLQDSPQDSPPEVHESTIIFDK
SSPTIWSSNKHSYSHIHLEGSYTSQGSYPHNLLINLFHPTDPNRNHTIHVNNGDMNVDYGKDSVADGLNFNKITATIPSD
AWYSGTITSMHLFNDNNFKTITPKFELSNELENITTQVNALFASSAQDTLASNVSDYWIEQVVMKVDALSDEVFGKEKKA
LRKLVNQAKRLSKIRNLLIGGNFDNLVAWYMGKDVVKESDHELFKSDHVLLPPPTFHPSYIFQKVEESKLKPNTRYTISG
FIAHGEDVELVVSRYGQEIQKVMQVPYEEALPLTSESNSSCCVPNLNINETLADPHFFSYSIDVGSLEMEANPGIEFGLR
IVKPTGMARVSNLEIREDRPLTAKEIRQVQRAARDWKQNYEQERTEITAIIQPVLNQINALYENEDWNGSIRSNVSYHDL
EQIMLPTLLKTEEINCNYDHPAFLLKVYHWFMTDRIGEHGTILARFQEALDRAYTQLESRNLLHNGHFTTDTANWTIEGD
AHHTILEDGRRVLRLPDWSSNATQTIEIEDFDLDQEYQLLIHAKGKGSITLQHGEENEYVETHTHHTNDFITSQNIPFTF
KGNQIEVHITSEDGEFLIDHITVIEVSKTDTNTNIIENSPINTSMNSNVRVDIPRSL
| 46899 | Cry12Aa1 | No | Not applicable | Rhabditida | Panagrellus redivivus | No | 6233 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-05-10 |
| 927 | MATLNEVYPVNYNVLSSDAFQQLDTTGFKSKYDEMIKAFEKKWKKGAKGKDLLDVAWTYITTGEIDPLNVIKGVLSVLTL
IPEVGTVASAASTIVSFIWPKIFGDKPNAKNIFEELKPQIEALIQQDITNYQDAINQKKFDSLQKTINLYTVAIDNNDYV
TAKTQLENLNSILTSDISIFIPEGYETGGLPYYAMVANAHILLLRDAIVNAEKLGFSDKEVDTHKKYIKMTIHNHTEAVI
KAFLNGLDKFKSLDVNSYNKKANYIKGMTEMVLDLVALWPTFDPDHYQKEVEIEFTRTISSPIYQPVPKNMQNTSSSIVP
SDLFHYQGDLVKLEFSTRTDNDGLAKIFTGIRNTFYKSPNTHETYHVDFSYNTQSSGNISRGSSNPIPIDLNNPIISTCI
RNSFYKAIAGSSVLVNFKDGTQGYAFAQAPTGGAWDHSFIESDGAPEGHKLNYIYTSPGDTLRDFINVYTLISTPTINEL
STEKIKGFPAEKGYIKNQGIMKYYGKPEYINGAQPVNLENQQTLIFEFHASKTAQYTIRIRYASTQGTKGYFRLDNQELQ
TLNIPTSHNGYVTGNIGENYDLYTIGSYTITEGNHTLQIQHNDKNGMVLDRIEFVPKDSLQDSPQDSPPEVHESTIIFDK
SSPTIWSSNKHSYSHIHLEGSYTSQGSYPHNLLINLFHPTDPNRNHTIHVNNGDMNVDYGKDSVADGLNFNKITATIPSD
AWYSGTITSMHLFNDNNFKTITPKFELSNELENITTQVNALFASSAQDTLASNVSDYWIEQVVMKVDALSDEVFGKEKKA
LRKLVNQAKRLSKIRNLLIGGNFDNLVAWYMGKDVVKESDHELFKSDHVLLPPPTFHPSYIFQKVEESKLKPNTRYTISG
FIAHGEDVELVVSRYGQEIQKVMQVPYEEALPLTSESNSSCCVPNLNINETLADPHFFSYSIDVGSLEMEANPGIEFGLR
IVKPTGMARVSNLEIREDRPLTAKEIRQVQRAARDWKQNYEQERTEITAIIQPVLNQINALYENEDWNGSIRSNVSYHDL
EQIMLPTLLKTEEINCNYDHPAFLLKVYHWFMTDRIGEHGTILARFQEALDRAYTQLESRNLLHNGHFTTDTANWTIEGD
AHHTILEDGRRVLRLPDWSSNATQTIEIEDFDLDQEYQLLIHAKGKGSITLQHGEENEYVETHTHHTNDFITSQNIPFTF
KGNQIEVHITSEDGEFLIDHITVIEVSKTDTNTNIIENSPINTSMNSNVRVDIPRSL
| 46896 | Cry12Aa1 | No | Not applicable | Rhabditida | Acrobeloides sp. | No | 70201 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-02-10 |
| 928 | MATLNEVYPVNYNVLSSDAFQQLDTTGFKSKYDEMIKAFEKKWKKGAKGKDLLDVAWTYITTGEIDPLNVIKGVLSVLTL
IPEVGTVASAASTIVSFIWPKIFGDKPNAKNIFEELKPQIEALIQQDITNYQDAINQKKFDSLQKTINLYTVAIDNNDYV
TAKTQLENLNSILTSDISIFIPEGYETGGLPYYAMVANAHILLLRDAIVNAEKLGFSDKEVDTHKKYIKMTIHNHTEAVI
KAFLNGLDKFKSLDVNSYNKKANYIKGMTEMVLDLVALWPTFDPDHYQKEVEIEFTRTISSPIYQPVPKNMQNTSSSIVP
SDLFHYQGDLVKLEFSTRTDNDGLAKIFTGIRNTFYKSPNTHETYHVDFSYNTQSSGNISRGSSNPIPIDLNNPIISTCI
RNSFYKAIAGSSVLVNFKDGTQGYAFAQAPTGGAWDHSFIESDGAPEGHKLNYIYTSPGDTLRDFINVYTLISTPTINEL
STEKIKGFPAEKGYIKNQGIMKYYGKPEYINGAQPVNLENQQTLIFEFHASKTAQYTIRIRYASTQGTKGYFRLDNQELQ
TLNIPTSHNGYVTGNIGENYDLYTIGSYTITEGNHTLQIQHNDKNGMVLDRIEFVPKDSLQDSPQDSPPEVHESTIIFDK
SSPTIWSSNKHSYSHIHLEGSYTSQGSYPHNLLINLFHPTDPNRNHTIHVNNGDMNVDYGKDSVADGLNFNKITATIPSD
AWYSGTITSMHLFNDNNFKTITPKFELSNELENITTQVNALFASSAQDTLASNVSDYWIEQVVMKVDALSDEVFGKEKKA
LRKLVNQAKRLSKIRNLLIGGNFDNLVAWYMGKDVVKESDHELFKSDHVLLPPPTFHPSYIFQKVEESKLKPNTRYTISG
FIAHGEDVELVVSRYGQEIQKVMQVPYEEALPLTSESNSSCCVPNLNINETLADPHFFSYSIDVGSLEMEANPGIEFGLR
IVKPTGMARVSNLEIREDRPLTAKEIRQVQRAARDWKQNYEQERTEITAIIQPVLNQINALYENEDWNGSIRSNVSYHDL
EQIMLPTLLKTEEINCNYDHPAFLLKVYHWFMTDRIGEHGTILARFQEALDRAYTQLESRNLLHNGHFTTDTANWTIEGD
AHHTILEDGRRVLRLPDWSSNATQTIEIEDFDLDQEYQLLIHAKGKGSITLQHGEENEYVETHTHHTNDFITSQNIPFTF
KGNQIEVHITSEDGEFLIDHITVIEVSKTDTNTNIIENSPINTSMNSNVRVDIPRSL
| 46898 | Cry12Aa1 | No | Not applicable | Rhabditida | Distolabrellus veechi | No | 96664 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-04-10 |
| 929 | MATLNEVYPVNYNVLSSDAFQQLDTTGFKSKYDEMIKAFEKKWKKGAKGKDLLDVAWTYITTGEIDPLNVIKGVLSVLTL
IPEVGTVASAASTIVSFIWPKIFGDKPNAKNIFEELKPQIEALIQQDITNYQDAINQKKFDSLQKTINLYTVAIDNNDYV
TAKTQLENLNSILTSDISIFIPEGYETGGLPYYAMVANAHILLLRDAIVNAEKLGFSDKEVDTHKKYIKMTIHNHTEAVI
KAFLNGLDKFKSLDVNSYNKKANYIKGMTEMVLDLVALWPTFDPDHYQKEVEIEFTRTISSPIYQPVPKNMQNTSSSIVP
SDLFHYQGDLVKLEFSTRTDNDGLAKIFTGIRNTFYKSPNTHETYHVDFSYNTQSSGNISRGSSNPIPIDLNNPIISTCI
RNSFYKAIAGSSVLVNFKDGTQGYAFAQAPTGGAWDHSFIESDGAPEGHKLNYIYTSPGDTLRDFINVYTLISTPTINEL
STEKIKGFPAEKGYIKNQGIMKYYGKPEYINGAQPVNLENQQTLIFEFHASKTAQYTIRIRYASTQGTKGYFRLDNQELQ
TLNIPTSHNGYVTGNIGENYDLYTIGSYTITEGNHTLQIQHNDKNGMVLDRIEFVPKDSLQDSPQDSPPEVHESTIIFDK
SSPTIWSSNKHSYSHIHLEGSYTSQGSYPHNLLINLFHPTDPNRNHTIHVNNGDMNVDYGKDSVADGLNFNKITATIPSD
AWYSGTITSMHLFNDNNFKTITPKFELSNELENITTQVNALFASSAQDTLASNVSDYWIEQVVMKVDALSDEVFGKEKKA
LRKLVNQAKRLSKIRNLLIGGNFDNLVAWYMGKDVVKESDHELFKSDHVLLPPPTFHPSYIFQKVEESKLKPNTRYTISG
FIAHGEDVELVVSRYGQEIQKVMQVPYEEALPLTSESNSSCCVPNLNINETLADPHFFSYSIDVGSLEMEANPGIEFGLR
IVKPTGMARVSNLEIREDRPLTAKEIRQVQRAARDWKQNYEQERTEITAIIQPVLNQINALYENEDWNGSIRSNVSYHDL
EQIMLPTLLKTEEINCNYDHPAFLLKVYHWFMTDRIGEHGTILARFQEALDRAYTQLESRNLLHNGHFTTDTANWTIEGD
AHHTILEDGRRVLRLPDWSSNATQTIEIEDFDLDQEYQLLIHAKGKGSITLQHGEENEYVETHTHHTNDFITSQNIPFTF
KGNQIEVHITSEDGEFLIDHITVIEVSKTDTNTNIIENSPINTSMNSNVRVDIPRSL
| 46897 | Cry12Aa1 | No | Not applicable | Rhabditida | Caenorhabditis elegans | No | 6239 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-03-10 |
| 930 | MTCQLQAQPLIPYNVLAGVPTSNTGSPIGNAGNQFDQFEQTVKELKEAWEAFQKNGSFSLAALEKGFDAAIGGGSFDYLG
LVQAGLGLVGTLGAAIPGVSVAVPLISMLVGVFWPKGTNNQENLITVIDKEVQRILDEKLSDQLIKKLNADLNAFTDLVT
RLEEVIIDATFENHKPVLQVSKSNYMKVDSAYFSTGGILTLGMSDFLTDTYSKLTFPLYVLGATMKLSAYHSYIQFGNTW
LNKVYDLSSDEGKTMSQALARAKQHMRQDIAFYTSQALNMFTGNLPSLSSNKYAINDYNVYTRAMVLNGLDIVATWPTLY
PDDYSSQIKLEKTRVIFSDMVGQSESRDGSVTIKNIFDNTDSHQHGSIGLNSISYFPDELQKAQLRMYDYNHKPYCTDCF
CWPYGVILNYNKNTFRYGDNDPGLSGDVQLPAPMSVVNAQTQTAQYTDGENIWTDTGRSWLCTLRGYCTTNCFPGRGCYN
NSTGYGESCNQSLPGQKIHALYPFTQTNVLGQSGKLGLLASHIPYDLSPNNTIGDKDTDSTNIVAKGIPVEKGYASSGQK
VEIIREWINGANVVQLSPGQSWGMDFTNSTGGQYMVRCRYASTNDTPIFFNLVYDGGSNPIYNQMTFPATKETPAHDSVD
NKILGIKGINGNYSLMNVKDSVELPSGKFHVFFTNNGSSAIYLDRLEFVPLDQPAAPTQSTQPINYPITSRLPHRSGEPP
AIIWEKSGNVRGNQLTISAQGVPENSQIYLSVGGDRQILDRSNGFKLVNYSPTYSFTNIQASSSNLVDITSGTITGQVQV
SNL
| 46662 | Cry13Aa1 | No | Not applicable | Rhabditida | Bursaphelenchus xylophilus | Yes | 6326 | 53.17 | µg/ml | | | 10.1016/j.jip.2022.107726 | | | | Purified protein | Addition to water | 4th stage juveniles assayed. | Colin Berry | 2024-11-02 |
| 931 | MTCQLQAQPLIPYNVLAGVPTSNTGSPIGNAGNQFDQFEQTVKELKEAWEAFQKNGSFSLAALEKGFDAAIGGGSFDYLG
LVQAGLGLVGTLGAAIPGVSVAVPLISMLVGVFWPKGTNNQENLITVIDKEVQRILDEKLSDQLIKKLNADLNAFTDLVT
RLEEVIIDATFENHKPVLQVSKSNYMKVDSAYFSTGGILTLGMSDFLTDTYSKLTFPLYVLGATMKLSAYHSYIQFGNTW
LNKVYDLSSDEGKTMSQALARAKQHMRQDIAFYTSQALNMFTGNLPSLSSNKYAINDYNVYTRAMVLNGLDIVATWPTLY
PDDYSSQIKLEKTRVIFSDMVGQSESRDGSVTIKNIFDNTDSHQHGSIGLNSISYFPDELQKAQLRMYDYNHKPYCTDCF
CWPYGVILNYNKNTFRYGDNDPGLSGDVQLPAPMSVVNAQTQTAQYTDGENIWTDTGRSWLCTLRGYCTTNCFPGRGCYN
NSTGYGESCNQSLPGQKIHALYPFTQTNVLGQSGKLGLLASHIPYDLSPNNTIGDKDTDSTNIVAKGIPVEKGYASSGQK
VEIIREWINGANVVQLSPGQSWGMDFTNSTGGQYMVRCRYASTNDTPIFFNLVYDGGSNPIYNQMTFPATKETPAHDSVD
NKILGIKGINGNYSLMNVKDSVELPSGKFHVFFTNNGSSAIYLDRLEFVPLDQPAAPTQSTQPINYPITSRLPHRSGEPP
AIIWEKSGNVRGNQLTISAQGVPENSQIYLSVGGDRQILDRSNGFKLVNYSPTYSFTNIQASSSNLVDITSGTITGQVQV
SNL
| 137980 | Cry13Aa1 | No | Not applicable | Rhabditida | Bursaphelenchus xylophilus | Yes | 6326 | | | | 0.395 | 10.1016/j.jip.2025.108279 | | Juveniles | J3 and J4 | Purified protein | Addition to water | 39.5% mortality at 24h (higher at 48h but figure not provided) | Colin Berry | 2025-09-04 |
| 932 | | 138415 | Cry14Aa | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | 0.12 | % Cry14Ab expressing bacteria | | | 10.1371/journal.ppat.1012611 | | | L4 | Whole cells | | Results expressed as IC50 in % of Cry14 expressing bacteria | Colin Berry | 2025-09-04 |
| 933 | MDCNLQSQQNIPYNVLAIPVSNVNALVDTAGDLKKAWEEFQKTGSFSLTALQQGFSASQGGAFNYLTLLQSGISLAGSFV
PGGTFVAPIVNMVIGWLWPHKNKTADTENLIKLIDEEIQKQLNKALLDQDRNNWTSFLESIFDTSATVSNAIIDAQWSGT
VDTTNRQQKTPTTSDYLNVVGKFDSADSSIITNENQIMNGNFDVAAAPYFVIGATLRLSLYQSYIKFCNSWIDAVGFSTN
DANTQKANLARTKLTMRTTINEYTQRVMKVFKDSKNMPTIGTNKFSVDAYNVYVKGMTLNVLDMVAIWSSLYPNDYTSQT
AIEQTRVTFSNMVGQEEGTDGTLKIYNTFDSLSYQHSLIPNNNVNLISYYTDELQNLELAVYTPKGGSGYAYPYGFILNY
ANSNYKYGDNDPTGKPLNKQDGPIQQINAATQNSKYLDGETINGIGASLPGYCTTGCSATEQPFSCTSTANSYKASCNPS
DTNQKINALYAFTQTNVKGSTGKLGVLASLVPYDLNPKNVFGELDSDTNNVILKGIPAEKGYFPNNARPTVVKEWINGAS
AVPFYSGNTLFMTATNLTATQYKIRIRYANPNSDTQIGVLITQNGSQISNSNLTLYSTTDSSMSSNLPQNVYVTGENGNY
TLLDLYSTTNVLSTGDITLKLTGGNQKIFIDRIEFIPTMPVPAPTNNTNNNNGDNGNNNPPHHGCAIAGTQQLCSGPPKF
EQVSDLEKITTQVYMLFKSSSYEELALKVSSYQINQVALKVMALSDEKFCEEKRLLRKLVNKANQLLEARNLLVGGNFET
TQNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDESTLKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILN
VPYAGPLPITADASITCCAPEIDQCDGGQSDSHFFNYSIDVGALHPELNPGIEIGLKIVQSNGYITISNLEIIEERPLTE
MEIQAVNRKDQKWKREKLLECASVSELLQPIINQIDSLFKDANWYNDILPHVTYQTLKNIIVPDLPKLKHWFIDHLPGEY
HEIEQKMKEALKHAFTQLDEKNLIHNGHFATNLIDWQVEGDARMKVLENNALALQLSNWDSSVSQSIDILEFDEDKAYKL
RVYAQGSGTIQFGNCEDEAIQFNTNSFVYKEKIIYFDTPSINLHIQSEGSEFVVSSIDLVELSDDE
| 46663 | Cry14Aa1 | No | Not applicable | Rhabditida | Bursaphelenchus xylophilus | Yes | 6326 | | | | approx 50% at 150 µg/ml | 10.1016/j.jip.2022.107726 | | | | Purified protein | Addition to water | 4th stage juveniles assayed. | Colin Berry | 2024-12-02 |
| 934 | | 47096 | Cry14Aa1T164I | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | 11.2 | ng/ml | | | 10.1126/science.1062441 | | | | | | Concentration measured in ED50, not lc50 | Colin Berry | 2024-04-20 |
| 935 | | 46906 | Cry14Aa1T164I | No | Not applicable | Rhabditida | Pristionchus pacificus | No | 54126 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-12-10 |
| 936 | | 46905 | Cry14Aa1T164I | No | Not applicable | Rhabditida | Panagrellus redivivus | Yes | 6233 | | | | | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-11-10 |
| 937 | | 46904 | Cry14Aa1T164I | No | Not applicable | Rhabditida | Nippostrongylus brasiliensis | Yes | 27835 | | | | | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-10-10 |
| 938 | | 46903 | Cry14Aa1T164I | No | Not applicable | Rhabditida | Distolabrellus veechi | Yes | 96664 | | | | | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-09-10 |
| 939 | | 46902 | Cry14Aa1T164I | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | | | | | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-08-10 |
| 940 | | 46901 | Cry14Aa1T164I | No | Not applicable | Rhabditida | Acrobeloides sp. | No | 70201 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.0538072100 | | | | Other (add to comments) | | Recombinant E. coli | Colin Berry | 2024-07-10 |
| 941 | | 138416 | Cry14Ab | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | 0.31 | % Cry14Aa expressing bacteria | | | 10.1371/journal.ppat.1012611 | | | L4 | Whole cells | | Results expressed as IC50 in % of Cry14 expressing bacteria | Colin Berry | 2025-09-04 |
| 942 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTVGDLKKAWEEFQKTGSFSLTALQQGFSASQGGTFNYLTLLQSGISLAGSFV
PGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQKQLNKALLDADRNEWSSYLESIFDSSNNLNGAIVDAQWSGT
VNTTNRTLRNPTESDYTNVVTNFIAADGDIANNENHIMNGNFDVAAAPYFVIGATARFAAMQSYIKFCNAWIDKVGLSDA
QLTTQKANLDRTKQNMRNAILNYTQQVMKVFKDSKNMPTIGTNKFSVDTYNVYIKGMTLNVLDIVAIWPSLYPDDYTSQT
ALEQTRVTFSNMVGQEEGTDGSLRIYNTFDSFSYQHSPIPNNNVNLISYYNDELQNLELGVYTPPKKGSGYSYPYGFVLN
YANSKYKYGDSNDPESLGGLSTLSAPIQQVNAATQNSKYLDGEILNGIGASLPGYCTTGCSPTEPPFSCTSTANGYKASC
NPSDTNQKINALYPFTQANVKGNTGKLGVLASLVSYDLNPKNVFGELDSDTNNVILKGIPAEKGYFPNNARPTVVKEWIN
GASAVPLDSGNTLFMTATNLTATQYRIRIRYANPNSNTQIGVRITQNGSLISSSNLTLYSTTDMNNTLPLNVYVIGENGN
YTLQDLYNTTNVLSTGDITLQITGGDQKIFIDRIEFVPTMPVPGNTNNNNGNNNGNNNPPHHVCAIAGTQQSCSGPPKFE
QVSDLEKITTQVYMLFKSSPYEELALEVSSYQISQVALKVMALSDELFCEEKNVLRKLVNKAKQLLEASNLLVGGNFETT
QNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDESTLKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNV
PYAGPLPITADASITCCAPEIGQCDGEQSDSHFFNYSIDVGALHPELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEM
EIQAVNRKNQKWEREKLLECASISELLQPIINQIDSLFKDGNWYNDILPHVTYQDLKNIIIPELPKLKHWFIENLPGEYH
EIEQKMKEALKYAFTQLDEKNLIHNGHFTTNLIDWQVEGDAQMKVLENDALALQLFNWDASASQSINILEFDEDKAYKLR
VYAQGSGTIQFGNCEDEAIQFNTNSFIYQEKIVYFDTPSVNLHIQSEGSEFIVSSIDLIELSDDQ
| 46769 | Cry14Ab1 | No | Not applicable | Rhabditida | Heterodera glycines | Yes | 51029 | 7 | µg/ml | | | 10.1038/s41467-021-23743-3 | | Not specified | | Vegetative cells | Addition to water | | Colin Berry | 2024-05-28 |
| 943 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTVGDLKKAWEEFQKTGSFSLTALQQGFSASQGGTFNYLTLLQSGISLAGSFV
PGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQKQLNKALLDADRNEWSSYLESIFDSSNNLNGAIVDAQWSGT
VNTTNRTLRNPTESDYTNVVTNFIAADGDIANNENHIMNGNFDVAAAPYFVIGATARFAAMQSYIKFCNAWIDKVGLSDA
QLTTQKANLDRTKQNMRNAILNYTQQVMKVFKDSKNMPTIGTNKFSVDTYNVYIKGMTLNVLDIVAIWPSLYPDDYTSQT
ALEQTRVTFSNMVGQEEGTDGSLRIYNTFDSFSYQHSPIPNNNVNLISYYNDELQNLELGVYTPPKKGSGYSYPYGFVLN
YANSKYKYGDSNDPESLGGLSTLSAPIQQVNAATQNSKYLDGEILNGIGASLPGYCTTGCSPTEPPFSCTSTANGYKASC
NPSDTNQKINALYPFTQANVKGNTGKLGVLASLVSYDLNPKNVFGELDSDTNNVILKGIPAEKGYFPNNARPTVVKEWIN
GASAVPLDSGNTLFMTATNLTATQYRIRIRYANPNSNTQIGVRITQNGSLISSSNLTLYSTTDMNNTLPLNVYVIGENGN
YTLQDLYNTTNVLSTGDITLQITGGDQKIFIDRIEFVPTMPVPGNTNNNNGNNNGNNNPPHHVCAIAGTQQSCSGPPKFE
QVSDLEKITTQVYMLFKSSPYEELALEVSSYQISQVALKVMALSDELFCEEKNVLRKLVNKAKQLLEASNLLVGGNFETT
QNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDESTLKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNV
PYAGPLPITADASITCCAPEIGQCDGEQSDSHFFNYSIDVGALHPELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEM
EIQAVNRKNQKWEREKLLECASISELLQPIINQIDSLFKDGNWYNDILPHVTYQDLKNIIIPELPKLKHWFIENLPGEYH
EIEQKMKEALKYAFTQLDEKNLIHNGHFTTNLIDWQVEGDAQMKVLENDALALQLFNWDASASQSINILEFDEDKAYKLR
VYAQGSGTIQFGNCEDEAIQFNTNSFIYQEKIVYFDTPSVNLHIQSEGSEFIVSSIDLIELSDDQ
| 138397 | Cry14Ab1 | No | Not applicable | Rhabditida | Ascaris suum | Yes | 6253 | | | | | 10.1371/journal.pntd.0012611 | | | | | | | Colin Berry | 2025-09-04 |
| 944 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTVGDLKKAWEEFQKTGSFSLTALQQGFSASQGGTFNYLTLLQSGISLAGSFV
PGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQKQLNKALLDADRNEWSSYLESIFDSSNNLNGAIVDAQWSGT
VNTTNRTLRNPTESDYTNVVTNFIAADGDIANNENHIMNGNFDVAAAPYFVIGATARFAAMQSYIKFCNAWIDKVGLSDA
QLTTQKANLDRTKQNMRNAILNYTQQVMKVFKDSKNMPTIGTNKFSVDTYNVYIKGMTLNVLDIVAIWPSLYPDDYTSQT
ALEQTRVTFSNMVGQEEGTDGSLRIYNTFDSFSYQHSPIPNNNVNLISYYNDELQNLELGVYTPPKKGSGYSYPYGFVLN
YANSKYKYGDSNDPESLGGLSTLSAPIQQVNAATQNSKYLDGEILNGIGASLPGYCTTGCSPTEPPFSCTSTANGYKASC
NPSDTNQKINALYPFTQANVKGNTGKLGVLASLVSYDLNPKNVFGELDSDTNNVILKGIPAEKGYFPNNARPTVVKEWIN
GASAVPLDSGNTLFMTATNLTATQYRIRIRYANPNSNTQIGVRITQNGSLISSSNLTLYSTTDMNNTLPLNVYVIGENGN
YTLQDLYNTTNVLSTGDITLQITGGDQKIFIDRIEFVPTMPVPGNTNNNNGNNNGNNNPPHHVCAIAGTQQSCSGPPKFE
QVSDLEKITTQVYMLFKSSPYEELALEVSSYQISQVALKVMALSDELFCEEKNVLRKLVNKAKQLLEASNLLVGGNFETT
QNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDESTLKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNV
PYAGPLPITADASITCCAPEIGQCDGEQSDSHFFNYSIDVGALHPELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEM
EIQAVNRKNQKWEREKLLECASISELLQPIINQIDSLFKDGNWYNDILPHVTYQDLKNIIIPELPKLKHWFIENLPGEYH
EIEQKMKEALKYAFTQLDEKNLIHNGHFTTNLIDWQVEGDAQMKVLENDALALQLFNWDASASQSINILEFDEDKAYKLR
VYAQGSGTIQFGNCEDEAIQFNTNSFIYQEKIVYFDTPSVNLHIQSEGSEFIVSSIDLIELSDDQ
| 138398 | Cry14Ab1 | No | Not applicable | Rhabditida | Trichuris muris | Yes | 70415 | | | | | 10.1371/journal.pntd.0012611 | | | | | | | Colin Berry | 2025-09-04 |
| 945 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTVGDLKKAWEEFQKTGSFSLTALQQGFSASQGGTFNYLTLLQSGISLAGSFV
PGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQKQLNKALLDADRNEWSSYLESIFDSSNNLNGAIVDAQWSGT
VNTTNRTLRNPTESDYTNVVTNFIAADGDIANNENHIMNGNFDVAAAPYFVIGATARFAAMQSYIKFCNAWIDKVGLSDA
QLTTQKANLDRTKQNMRNAILNYTQQVMKVFKDSKNMPTIGTNKFSVDTYNVYIKGMTLNVLDIVAIWPSLYPDDYTSQT
ALEQTRVTFSNMVGQEEGTDGSLRIYNTFDSFSYQHSPIPNNNVNLISYYNDELQNLELGVYTPPKKGSGYSYPYGFVLN
YANSKYKYGDSNDPESLGGLSTLSAPIQQVNAATQNSKYLDGEILNGIGASLPGYCTTGCSPTEPPFSCTSTANGYKASC
NPSDTNQKINALYPFTQANVKGNTGKLGVLASLVSYDLNPKNVFGELDSDTNNVILKGIPAEKGYFPNNARPTVVKEWIN
GASAVPLDSGNTLFMTATNLTATQYRIRIRYANPNSNTQIGVRITQNGSLISSSNLTLYSTTDMNNTLPLNVYVIGENGN
YTLQDLYNTTNVLSTGDITLQITGGDQKIFIDRIEFVPTMPVPGNTNNNNGNNNGNNNPPHHVCAIAGTQQSCSGPPKFE
QVSDLEKITTQVYMLFKSSPYEELALEVSSYQISQVALKVMALSDELFCEEKNVLRKLVNKAKQLLEASNLLVGGNFETT
QNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDESTLKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNV
PYAGPLPITADASITCCAPEIGQCDGEQSDSHFFNYSIDVGALHPELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEM
EIQAVNRKNQKWEREKLLECASISELLQPIINQIDSLFKDGNWYNDILPHVTYQDLKNIIIPELPKLKHWFIENLPGEYH
EIEQKMKEALKYAFTQLDEKNLIHNGHFTTNLIDWQVEGDAQMKVLENDALALQLFNWDASASQSINILEFDEDKAYKLR
VYAQGSGTIQFGNCEDEAIQFNTNSFIYQEKIVYFDTPSVNLHIQSEGSEFIVSSIDLIELSDDQ
| 138400 | Cry14Ab1 | No | Not applicable | Rhabditida | Heligmosomoides polygyrus bakeri | Yes | 375939 | | | | | 10.1371/journal.pntd.0012611 | | | | | | | Colin Berry | 2025-09-04 |
| 946 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTVGDLKKAWEEFQKTGSFSLTALQQGFSASQGGTFNYLTLLQSGISLAGSFV
PGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQKQLNKALLDADRNEWSSYLESIFDSSNNLNGAIVDAQWSGT
VNTTNRTLRNPTESDYTNVVTNFIAADGDIANNENHIMNGNFDVAAAPYFVIGATARFAAMQSYIKFCNAWIDKVGLSDA
QLTTQKANLDRTKQNMRNAILNYTQQVMKVFKDSKNMPTIGTNKFSVDTYNVYIKGMTLNVLDIVAIWPSLYPDDYTSQT
ALEQTRVTFSNMVGQEEGTDGSLRIYNTFDSFSYQHSPIPNNNVNLISYYNDELQNLELGVYTPPKKGSGYSYPYGFVLN
YANSKYKYGDSNDPESLGGLSTLSAPIQQVNAATQNSKYLDGEILNGIGASLPGYCTTGCSPTEPPFSCTSTANGYKASC
NPSDTNQKINALYPFTQANVKGNTGKLGVLASLVSYDLNPKNVFGELDSDTNNVILKGIPAEKGYFPNNARPTVVKEWIN
GASAVPLDSGNTLFMTATNLTATQYRIRIRYANPNSNTQIGVRITQNGSLISSSNLTLYSTTDMNNTLPLNVYVIGENGN
YTLQDLYNTTNVLSTGDITLQITGGDQKIFIDRIEFVPTMPVPGNTNNNNGNNNGNNNPPHHVCAIAGTQQSCSGPPKFE
QVSDLEKITTQVYMLFKSSPYEELALEVSSYQISQVALKVMALSDELFCEEKNVLRKLVNKAKQLLEASNLLVGGNFETT
QNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDESTLKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNV
PYAGPLPITADASITCCAPEIGQCDGEQSDSHFFNYSIDVGALHPELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEM
EIQAVNRKNQKWEREKLLECASISELLQPIINQIDSLFKDGNWYNDILPHVTYQDLKNIIIPELPKLKHWFIENLPGEYH
EIEQKMKEALKYAFTQLDEKNLIHNGHFTTNLIDWQVEGDAQMKVLENDALALQLFNWDASASQSINILEFDEDKAYKLR
VYAQGSGTIQFGNCEDEAIQFNTNSFIYQEKIVYFDTPSVNLHIQSEGSEFIVSSIDLIELSDDQ
| 138396 | Cry14Ab1 | No | Not applicable | Rhabditida | Ancylostoma ceylanicum | Yes | 53326 | | | | | 10.1371/journal.pntd.0012611 | | | | | | | Colin Berry | 2025-09-04 |
| 947 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTVGDLKKAWEEFQKTGSFSLTALQQGFSASQGGTFNYLTLLQSGISLAGSFV
PGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQKQLNKALLDADRNEWSSYLESIFDSSNNLNGAIVDAQWSGT
VNTTNRTLRNPTESDYTNVVTNFIAADGDIANNENHIMNGNFDVAAAPYFVIGATARFAAMQSYIKFCNAWIDKVGLSDA
QLTTQKANLDRTKQNMRNAILNYTQQVMKVFKDSKNMPTIGTNKFSVDTYNVYIKGMTLNVLDIVAIWPSLYPDDYTSQT
ALEQTRVTFSNMVGQEEGTDGSLRIYNTFDSFSYQHSPIPNNNVNLISYYNDELQNLELGVYTPPKKGSGYSYPYGFVLN
YANSKYKYGDSNDPESLGGLSTLSAPIQQVNAATQNSKYLDGEILNGIGASLPGYCTTGCSPTEPPFSCTSTANGYKASC
NPSDTNQKINALYPFTQANVKGNTGKLGVLASLVSYDLNPKNVFGELDSDTNNVILKGIPAEKGYFPNNARPTVVKEWIN
GASAVPLDSGNTLFMTATNLTATQYRIRIRYANPNSNTQIGVRITQNGSLISSSNLTLYSTTDMNNTLPLNVYVIGENGN
YTLQDLYNTTNVLSTGDITLQITGGDQKIFIDRIEFVPTMPVPGNTNNNNGNNNGNNNPPHHVCAIAGTQQSCSGPPKFE
QVSDLEKITTQVYMLFKSSPYEELALEVSSYQISQVALKVMALSDELFCEEKNVLRKLVNKAKQLLEASNLLVGGNFETT
QNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDESTLKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNV
PYAGPLPITADASITCCAPEIGQCDGEQSDSHFFNYSIDVGALHPELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEM
EIQAVNRKNQKWEREKLLECASISELLQPIINQIDSLFKDGNWYNDILPHVTYQDLKNIIIPELPKLKHWFIENLPGEYH
EIEQKMKEALKYAFTQLDEKNLIHNGHFTTNLIDWQVEGDAQMKVLENDALALQLFNWDASASQSINILEFDEDKAYKLR
VYAQGSGTIQFGNCEDEAIQFNTNSFIYQEKIVYFDTPSVNLHIQSEGSEFIVSSIDLIELSDDQ
| 138395 | Cry14Ab1 | No | Not applicable | Rhabditida | Haemonchus contortus | Yes | 6289 | | | | | 10.1371/journal.pntd.0012611 | | | | | | | Colin Berry | 2025-09-04 |
| 948 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTVGDLKKAWEEFQKTGSFSLTALQQGFSASQGGTFNYLTLLQSGISLAGSFV
PGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQKQLNKALLDADRNEWSSYLESIFDSSNNLNGAIVDAQWSGT
VNTTNRTLRNPTESDYTNVVTNFIAADGDIANNENHIMNGNFDVAAAPYFVIGATARFAAMQSYIKFCNAWIDKVGLSDA
QLTTQKANLDRTKQNMRNAILNYTQQVMKVFKDSKNMPTIGTNKFSVDTYNVYIKGMTLNVLDIVAIWPSLYPDDYTSQT
ALEQTRVTFSNMVGQEEGTDGSLRIYNTFDSFSYQHSPIPNNNVNLISYYNDELQNLELGVYTPPKKGSGYSYPYGFVLN
YANSKYKYGDSNDPESLGGLSTLSAPIQQVNAATQNSKYLDGEILNGIGASLPGYCTTGCSPTEPPFSCTSTANGYKASC
NPSDTNQKINALYPFTQANVKGNTGKLGVLASLVSYDLNPKNVFGELDSDTNNVILKGIPAEKGYFPNNARPTVVKEWIN
GASAVPLDSGNTLFMTATNLTATQYRIRIRYANPNSNTQIGVRITQNGSLISSSNLTLYSTTDMNNTLPLNVYVIGENGN
YTLQDLYNTTNVLSTGDITLQITGGDQKIFIDRIEFVPTMPVPGNTNNNNGNNNGNNNPPHHVCAIAGTQQSCSGPPKFE
QVSDLEKITTQVYMLFKSSPYEELALEVSSYQISQVALKVMALSDELFCEEKNVLRKLVNKAKQLLEASNLLVGGNFETT
QNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDESTLKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNV
PYAGPLPITADASITCCAPEIGQCDGEQSDSHFFNYSIDVGALHPELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEM
EIQAVNRKNQKWEREKLLECASISELLQPIINQIDSLFKDGNWYNDILPHVTYQDLKNIIIPELPKLKHWFIENLPGEYH
EIEQKMKEALKYAFTQLDEKNLIHNGHFTTNLIDWQVEGDAQMKVLENDALALQLFNWDASASQSINILEFDEDKAYKLR
VYAQGSGTIQFGNCEDEAIQFNTNSFIYQEKIVYFDTPSVNLHIQSEGSEFIVSSIDLIELSDDQ
| 138399 | Cry14Ab1 | No | Not applicable | Rhabditida | Necator americanus | Yes | 51031 | | | | | 10.1371/journal.pntd.0012611 | | | | | | | Colin Berry | 2025-09-04 |
| 949 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTIGDLKKAWEEFQKTGSFSLTALQQGFNAAQG
GTFNYLTLLQSGISLAGSFVPGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQK
QLNKALLDQDRQDWISYLESIFDSSNNLNGAIIDAQWSGTVNTTNRTLRNPTESDYLNVV
TNFIAADGDISSNEHHIMNGNFDVAAAPYFVIGATARFATMQSYIKFCNAWIDKVGLSDS
QLTTQKANLDRTKQTMRNAILSYTQQVMKVFKDPKNMPTIDTNKFSVDTYNVYVKGMTLN
VLDIVAIWPSLYPDDYTSQTSLEQTRVTFSNMVGQEEGTDGTVTIYNTFDSDSYRHKAIP
NNDVNLLSYFPDELQNVQLALYTPSKKDSGYTYPYAFISNYQYSRYQYGDNAPEGPLSTL
SAPIQSINAATQNTKYLDGETINGIGANLPGYCTSDCSPTQQPFSCTSTVNQFKQSCNPT
DTNQKINALYAFTQTNVKGNQGKLGLLASHVPYDLNPKNIFGELDPDTNNVILKGIPAEK
GYFSNNTRPNIVKEWINGANAVPLDSGNTLFMTATNVTATQYKIRIRYANPNSNTQIGVQ
ISQNGSIISNSNLTLYSTTDMNNTLPLNVYVTGENGNYTLLDLYSTTNVLSTGDITLKLT
GGDQKIFIDRIEFVPTMPVPGNTNNNNGDNGNNNPVHHVCAIAGTQQSCSGPPKFEQVSD
LEKITTQVYMLFKSSPYEELAPEVSSYQISQVALKVMALSDELFCKEKSLLRKLVNKAKQ
LLEASNLLVGGNFETTQNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDEST
LKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNVPYAGPLPITANALITCCAPEIGQC
DGKQSDSHFFNYSIDVGALHLELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEMEIQA
VNRKSQKWEREKLLECASINELLQPVINQIDSLFKDGNWYNDILPHITYQDLKNIIIPEL
PKLKHWFIEDLPGEYHEIEQKMKEALKHAFTQLDERNLIHNGHFTINLIDWQVEGDAQMK
VLENDALALQLFNWDSSASQSIKILEFDEDKAYKLRVYAQGNGTIQFGNCEDEAIQFNTN
SFIYQEKIVYFDTPSINVKIQSEGAEFVVSSVELIEL
| 138401 | Cry14Ac1 | No | Not applicable | Rhabditida | Caenorhabditis elegans | Yes | 6239 | | | | | 10.1371/journal.pntd.0012611 | | | | | | | Colin Berry | 2025-09-04 |
| 950 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTIGDLKKAWEEFQKTGSFSLTALQQGFNAAQG
GTFNYLTLLQSGISLAGSFVPGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQK
QLNKALLDQDRQDWISYLESIFDSSNNLNGAIIDAQWSGTVNTTNRTLRNPTESDYLNVV
TNFIAADGDISSNEHHIMNGNFDVAAAPYFVIGATARFATMQSYIKFCNAWIDKVGLSDS
QLTTQKANLDRTKQTMRNAILSYTQQVMKVFKDPKNMPTIDTNKFSVDTYNVYVKGMTLN
VLDIVAIWPSLYPDDYTSQTSLEQTRVTFSNMVGQEEGTDGTVTIYNTFDSDSYRHKAIP
NNDVNLLSYFPDELQNVQLALYTPSKKDSGYTYPYAFISNYQYSRYQYGDNAPEGPLSTL
SAPIQSINAATQNTKYLDGETINGIGANLPGYCTSDCSPTQQPFSCTSTVNQFKQSCNPT
DTNQKINALYAFTQTNVKGNQGKLGLLASHVPYDLNPKNIFGELDPDTNNVILKGIPAEK
GYFSNNTRPNIVKEWINGANAVPLDSGNTLFMTATNVTATQYKIRIRYANPNSNTQIGVQ
ISQNGSIISNSNLTLYSTTDMNNTLPLNVYVTGENGNYTLLDLYSTTNVLSTGDITLKLT
GGDQKIFIDRIEFVPTMPVPGNTNNNNGDNGNNNPVHHVCAIAGTQQSCSGPPKFEQVSD
LEKITTQVYMLFKSSPYEELAPEVSSYQISQVALKVMALSDELFCKEKSLLRKLVNKAKQ
LLEASNLLVGGNFETTQNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDEST
LKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNVPYAGPLPITANALITCCAPEIGQC
DGKQSDSHFFNYSIDVGALHLELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEMEIQA
VNRKSQKWEREKLLECASINELLQPVINQIDSLFKDGNWYNDILPHITYQDLKNIIIPEL
PKLKHWFIEDLPGEYHEIEQKMKEALKHAFTQLDERNLIHNGHFTINLIDWQVEGDAQMK
VLENDALALQLFNWDSSASQSIKILEFDEDKAYKLRVYAQGNGTIQFGNCEDEAIQFNTN
SFIYQEKIVYFDTPSINVKIQSEGAEFVVSSVELIEL
| 138402 | Cry14Ac1 | No | Not applicable | Rhabditida | Ancylostoma ceylanicum | Yes | 53326 | | | | | 10.1371/journal.pntd.0012611 | | | | | | | Colin Berry | 2025-09-04 |
| 951 | MDCNLQSQQNIPYNVLAIPVSNVNSLTDTIGDLKKAWEEFQKTGSFSLTALQQGFNAAQG
GTFNYLTLLQSGISLAGSFVPGGTFVAPIINMVIGWLWPHKNKNADTENLINLIDSEIQK
QLNKALLDQDRQDWISYLESIFDSSNNLNGAIIDAQWSGTVNTTNRTLRNPTESDYLNVV
TNFIAADGDISSNEHHIMNGNFDVAAAPYFVIGATARFATMQSYIKFCNAWIDKVGLSDS
QLTTQKANLDRTKQTMRNAILSYTQQVMKVFKDPKNMPTIDTNKFSVDTYNVYVKGMTLN
VLDIVAIWPSLYPDDYTSQTSLEQTRVTFSNMVGQEEGTDGTVTIYNTFDSDSYRHKAIP
NNDVNLLSYFPDELQNVQLALYTPSKKDSGYTYPYAFISNYQYSRYQYGDNAPEGPLSTL
SAPIQSINAATQNTKYLDGETINGIGANLPGYCTSDCSPTQQPFSCTSTVNQFKQSCNPT
DTNQKINALYAFTQTNVKGNQGKLGLLASHVPYDLNPKNIFGELDPDTNNVILKGIPAEK
GYFSNNTRPNIVKEWINGANAVPLDSGNTLFMTATNVTATQYKIRIRYANPNSNTQIGVQ
ISQNGSIISNSNLTLYSTTDMNNTLPLNVYVTGENGNYTLLDLYSTTNVLSTGDITLKLT
GGDQKIFIDRIEFVPTMPVPGNTNNNNGDNGNNNPVHHVCAIAGTQQSCSGPPKFEQVSD
LEKITTQVYMLFKSSPYEELAPEVSSYQISQVALKVMALSDELFCKEKSLLRKLVNKAKQ
LLEASNLLVGGNFETTQNWVLGTNAYINYDSFLFNGNYLSLQPASGFFTSYAYQKIDEST
LKPYTRYKVSGFIGQSNQVELIISRYGKEIDKILNVPYAGPLPITANALITCCAPEIGQC
DGKQSDSHFFNYSIDVGALHLELNPGIEIGLKIVQSNGYITISNLEIIEERPLTEMEIQA
VNRKSQKWEREKLLECASINELLQPVINQIDSLFKDGNWYNDILPHITYQDLKNIIIPEL
PKLKHWFIEDLPGEYHEIEQKMKEALKHAFTQLDERNLIHNGHFTINLIDWQVEGDAQMK
VLENDALALQLFNWDSSASQSIKILEFDEDKAYKLRVYAQGNGTIQFGNCEDEAIQFNTN
SFIYQEKIVYFDTPSINVKIQSEGAEFVVSSVELIEL
| 138403 | Cry14Ac1 | No | Not applicable | Rhabditida | Ascaris suum | Yes | 6253 | | | | | 10.1371/journal.pntd.0012611 | | | | | | | Colin Berry | 2025-09-04 |
| 952 | MNTNIFSTHLEFSKGVASVFKVIDTIHNISKNNNFNNILTQDFIIDTILSILWEDPNENEIFSSMIEDGETITNKNLSAQ
TKEGLLLNSNSFGLKFKYYNNAFRSWIDNYNPTSIDDVVYRFKDVNSICENNINEFKVKNYEVTVLPIYMQIANLHLLLL
RDGMIYGDAWNLYRELGFSDQDSFYNHVLDKTKFYINDCLNYYNTGLSNLKLDPNNSWIDITRYCRFMTFYILDMISICP
IYDTKVYDKPINMQTLTRKVYSDPVNFIDENIPISEYEKMYNISPELFSTLFSISFYTNKSGNKFLNGHVNRHVGTDLNY
NGLRETHYGNYGSNYEVESMAFDDIKAYSNNYFNNTQNNNPTSVKSIKFLITKNNDEWIYGEPDSSNIDFTRNIQGYLSN
LNNESYTHSLSDMILANNDKIQINIDTPHSYSYSWIYKGIEDTNYISDKLINQIPLVKEVKLKSRHYSEISVIKGPGFTG
GDLILSKVHKPANQIPAQYMKNKITIPIKTKFPAGSQDFKVRLCYASNHDIGLIRLIAGSKYITTNIQQTFNTTENNPSL
IYDDFKYFNFNETLSITSSGIDELYLEFYYSYTDGNFEDFPKLSIPYTRNYSC
| 129542 | Cry16Aa1 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 129 | µg/ml | | | 10.1128/jb.178.11.3099-3105.1996 | | Larvae | 2nd Instar | Other (add to comments) | Addition to water | Proteins TCA extracted from culture supernatants | Colin Berry | 2024-06-13 |
| 953 | MNTNIFSTHLEFSKGVASVFKVIDTIHNISKNNNFNNILTQDFIIDTILSILWEDPNENEIFSSMIEDGETITNKNLSAQ
TKEGLLLNSNSFGLKFKYYNNAFRSWIDNYNPTSIDDVVYRFKDVNSICENNINEFKVKNYEVTVLPIYMQIANLHLLLL
RDGMIYGDAWNLYRELGFSDQDSFYNHVLDKTKFYINDCLNYYNTGLSNLKLDPNNSWIDITRYCRFMTFYILDMISICP
IYDTKVYDKPINMQTLTRKVYSDPVNFIDENIPISEYEKMYNISPELFSTLFSISFYTNKSGNKFLNGHVNRHVGTDLNY
NGLRETHYGNYGSNYEVESMAFDDIKAYSNNYFNNTQNNNPTSVKSIKFLITKNNDEWIYGEPDSSNIDFTRNIQGYLSN
LNNESYTHSLSDMILANNDKIQINIDTPHSYSYSWIYKGIEDTNYISDKLINQIPLVKEVKLKSRHYSEISVIKGPGFTG
GDLILSKVHKPANQIPAQYMKNKITIPIKTKFPAGSQDFKVRLCYASNHDIGLIRLIAGSKYITTNIQQTFNTTENNPSL
IYDDFKYFNFNETLSITSSGIDELYLEFYYSYTDGNFEDFPKLSIPYTRNYSC
| 138994 | Cry16Aa1 | No | Not applicable | Diptera | Culex pipiens | No | 7175 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1006/jipa.2001.5042 | | Larvae | 2nd instar | | Addition to water | Not toxic up to 15µg/ml | Colin Berry | 2025-09-04 |
| 954 | MNTNIFSTHLEFSKGVASVFKVIDTIHNISKNNNFNNILTQDFIIDTILSILWEDPNENEIFSSMIEDGETITNKNLSAQ
TKEGLLLNSNSFGLKFKYYNNAFRSWIDNYNPTSIDDVVYRFKDVNSICENNINEFKVKNYEVTVLPIYMQIANLHLLLL
RDGMIYGDAWNLYRELGFSDQDSFYNHVLDKTKFYINDCLNYYNTGLSNLKLDPNNSWIDITRYCRFMTFYILDMISICP
IYDTKVYDKPINMQTLTRKVYSDPVNFIDENIPISEYEKMYNISPELFSTLFSISFYTNKSGNKFLNGHVNRHVGTDLNY
NGLRETHYGNYGSNYEVESMAFDDIKAYSNNYFNNTQNNNPTSVKSIKFLITKNNDEWIYGEPDSSNIDFTRNIQGYLSN
LNNESYTHSLSDMILANNDKIQINIDTPHSYSYSWIYKGIEDTNYISDKLINQIPLVKEVKLKSRHYSEISVIKGPGFTG
GDLILSKVHKPANQIPAQYMKNKITIPIKTKFPAGSQDFKVRLCYASNHDIGLIRLIAGSKYITTNIQQTFNTTENNPSL
IYDDFKYFNFNETLSITSSGIDELYLEFYYSYTDGNFEDFPKLSIPYTRNYSC
| 138995 | Cry16Aa1 | No | Not applicable | Diptera | Anopheles gambiae | No | 7165 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1006/jipa.2001.5042 | | Larvae | 2nd instar | | Addition to water | Not toxic up to 15µg/ml | Colin Berry | 2025-09-04 |
| 955 | MNTNIFSTHLEFSKGVASVFKVIDTIHNISKNNNFNNILTQDFIIDTILSILWEDPNENEIFSSMIEDGETITNKNLSAQ
TKEGLLLNSNSFGLKFKYYNNAFRSWIDNYNPTSIDDVVYRFKDVNSICENNINEFKVKNYEVTVLPIYMQIANLHLLLL
RDGMIYGDAWNLYRELGFSDQDSFYNHVLDKTKFYINDCLNYYNTGLSNLKLDPNNSWIDITRYCRFMTFYILDMISICP
IYDTKVYDKPINMQTLTRKVYSDPVNFIDENIPISEYEKMYNISPELFSTLFSISFYTNKSGNKFLNGHVNRHVGTDLNY
NGLRETHYGNYGSNYEVESMAFDDIKAYSNNYFNNTQNNNPTSVKSIKFLITKNNDEWIYGEPDSSNIDFTRNIQGYLSN
LNNESYTHSLSDMILANNDKIQINIDTPHSYSYSWIYKGIEDTNYISDKLINQIPLVKEVKLKSRHYSEISVIKGPGFTG
GDLILSKVHKPANQIPAQYMKNKITIPIKTKFPAGSQDFKVRLCYASNHDIGLIRLIAGSKYITTNIQQTFNTTENNPSL
IYDDFKYFNFNETLSITSSGIDELYLEFYYSYTDGNFEDFPKLSIPYTRNYSC
| 138999 | Cry16Aa1 | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/AEM.01139-14 | | Larvae | 3rd instar | | Addition to water | The wider operon with neighbouring genes may confer toxicity | Colin Berry | 2025-09-04 |
| 956 | MNTNIFSTHLEFSKGVASVFKVIDTIHNISKNNNFNNILTQDFIIDTILSILWEDPNENEIFSSMIEDGETITNKNLSAQ
TKEGLLLNSNSFGLKFKYYNNAFRSWIDNYNPTSIDDVVYRFKDVNSICENNINEFKVKNYEVTVLPIYMQIANLHLLLL
RDGMIYGDAWNLYRELGFSDQDSFYNHVLDKTKFYINDCLNYYNTGLSNLKLDPNNSWIDITRYCRFMTFYILDMISICP
IYDTKVYDKPINMQTLTRKVYSDPVNFIDENIPISEYEKMYNISPELFSTLFSISFYTNKSGNKFLNGHVNRHVGTDLNY
NGLRETHYGNYGSNYEVESMAFDDIKAYSNNYFNNTQNNNPTSVKSIKFLITKNNDEWIYGEPDSSNIDFTRNIQGYLSN
LNNESYTHSLSDMILANNDKIQINIDTPHSYSYSWIYKGIEDTNYISDKLINQIPLVKEVKLKSRHYSEISVIKGPGFTG
GDLILSKVHKPANQIPAQYMKNKITIPIKTKFPAGSQDFKVRLCYASNHDIGLIRLIAGSKYITTNIQQTFNTTENNPSL
IYDDFKYFNFNETLSITSSGIDELYLEFYYSYTDGNFEDFPKLSIPYTRNYSC
| 129543 | Cry16Aa1 | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 156 | µg/ml | | | 10.1128/jb.178.11.3099-3105.1996 | | Larvae | 2nd Instar | Other (add to comments) | Addition to water | Proteins TCA extracted from culture supernatants | Colin Berry | 2024-06-13 |
| 957 | MNTNIFSTHLEFSKGVASVFKVIDTIHNISKNNNFNNILTQDFIIDTILSILWEDPNENEIFSSMIEDGETITNKNLSAQ
TKEGLLLNSNSFGLKFKYYNNAFRSWIDNYNPTSIDDVVYRFKDVNSICENNINEFKVKNYEVTVLPIYMQIANLHLLLL
RDGMIYGDAWNLYRELGFSDQDSFYNHVLDKTKFYINDCLNYYNTGLSNLKLDPNNSWIDITRYCRFMTFYILDMISICP
IYDTKVYDKPINMQTLTRKVYSDPVNFIDENIPISEYEKMYNISPELFSTLFSISFYTNKSGNKFLNGHVNRHVGTDLNY
NGLRETHYGNYGSNYEVESMAFDDIKAYSNNYFNNTQNNNPTSVKSIKFLITKNNDEWIYGEPDSSNIDFTRNIQGYLSN
LNNESYTHSLSDMILANNDKIQINIDTPHSYSYSWIYKGIEDTNYISDKLINQIPLVKEVKLKSRHYSEISVIKGPGFTG
GDLILSKVHKPANQIPAQYMKNKITIPIKTKFPAGSQDFKVRLCYASNHDIGLIRLIAGSKYITTNIQQTFNTTENNPSL
IYDDFKYFNFNETLSITSSGIDELYLEFYYSYTDGNFEDFPKLSIPYTRNYSC
| 138993 | Cry16Aa1 | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1006/jipa.2001.5042 | | Larvae | 2nd instar | | Addition to water | Not toxic up to 15µg/ml | Colin Berry | 2025-09-04 |
| 958 | MNTNIFSTHLEFSKGVASVFKVIDTIHNISKNNNFNNILTQDFIIDTILSILWEDPNENEIFSSMIEDGETITNKNLSAQ
TKEGLLLNSNSFGLKFKYYNNAFRSWIDNYNPTSIDDVVYRFKDVNSICENNINEFKVKNYEVTVLPIYMQIANLHLLLL
RDGMIYGDAWNLYRELGFSDQDSFYNHVLDKTKFYINDCLNYYNTGLSNLKLDPNNSWIDITRYCRFMTFYILDMISICP
IYDTKVYDKPINMQTLTRKVYSDPVNFIDENIPISEYEKMYNISPELFSTLFSISFYTNKSGNKFLNGHVNRHVGTDLNY
NGLRETHYGNYGSNYEVESMAFDDIKAYSNNYFNNTQNNNPTSVKSIKFLITKNNDEWIYGEPDSSNIDFTRNIQGYLSN
LNNESYTHSLSDMILANNDKIQINIDTPHSYSYSWIYKGIEDTNYISDKLINQIPLVKEVKLKSRHYSEISVIKGPGFTG
GDLILSKVHKPANQIPAQYMKNKITIPIKTKFPAGSQDFKVRLCYASNHDIGLIRLIAGSKYITTNIQQTFNTTENNPSL
IYDDFKYFNFNETLSITSSGIDELYLEFYYSYTDGNFEDFPKLSIPYTRNYSC
| 129541 | Cry16Aa1 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 185 | µg/ml | | | 10.1128/jb.178.11.3099-3105.1996 | | Larvae | 2nd Instar | Other (add to comments) | Addition to water | Proteins TCA extracted from culture supernatants | Colin Berry | 2024-06-13 |
| 959 | MNNKKIEQNKIVEYNSNLDIQPRELNTLNGLVFTGATVSIILPLIGTTAVVPVVGGVIGIIAALLPVIWPAGTSSNDNLF
DAVMKDTEMIMDEKISEYVVNDAMTRLESLYNILDYYRLSKDFWEKNKDDPLAIAELKERFSKLHSQFIESMAYFKRANY
EVLLLPAYANAANLHLLLLREGLLLNKVIDNFITEGLHYEEFKTKRSTYIAHCSTWYNKGLENIKNKTRDFNKINKYDAY
MNLSVLDIISLFLSYDPYQYDKATKLQTLTRTVFSDPLQRAPRDLYISPKEETLFKNLKGLRAFFAEGDLVLTGFRNYFR
NTYINDQIIEGDLFGYTTNNERYKLFTDSKIYKVTVFIDNVALAIVKLIFHDTDNKEWDFSKTDITDINKYRKEEVYLNL
LSNNEIQKEPSHYLYKMHHYGDNYNDSYLFQWIHQSISPENYLFDKDKDDNYIITQIPAIKASELSNLGELSLQAIKGPR
FTGGNVILSSVSKIDNNDPLYGGTIKIPLLTAFNNTSKFKIRIYYAANHNYNHDYIGALLTINSQHVANFKFKQTFSGED
YSNLSYNNYQFDYLVQTVAFPQNTSDVTLNLQFFYDPKFLNDYKQIVIIDKIEFIPEN
| 129546 | Cry17Aa1 | No | Not applicable | Diptera | Culex pipiens | No | 7175 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/s0378-1119(98)00122-x | | Larvae | 2nd Instar | Other (add to comments) | Addition to water | Proteins TCA extracted from culture supernatants Low non-calculable activity reported >100µg in 2ml | Colin Berry | 2024-06-13 |
| 960 | MNNKKIEQNKIVEYNSNLDIQPRELNTLNGLVFTGATVSIILPLIGTTAVVPVVGGVIGIIAALLPVIWPAGTSSNDNLF
DAVMKDTEMIMDEKISEYVVNDAMTRLESLYNILDYYRLSKDFWEKNKDDPLAIAELKERFSKLHSQFIESMAYFKRANY
EVLLLPAYANAANLHLLLLREGLLLNKVIDNFITEGLHYEEFKTKRSTYIAHCSTWYNKGLENIKNKTRDFNKINKYDAY
MNLSVLDIISLFLSYDPYQYDKATKLQTLTRTVFSDPLQRAPRDLYISPKEETLFKNLKGLRAFFAEGDLVLTGFRNYFR
NTYINDQIIEGDLFGYTTNNERYKLFTDSKIYKVTVFIDNVALAIVKLIFHDTDNKEWDFSKTDITDINKYRKEEVYLNL
LSNNEIQKEPSHYLYKMHHYGDNYNDSYLFQWIHQSISPENYLFDKDKDDNYIITQIPAIKASELSNLGELSLQAIKGPR
FTGGNVILSSVSKIDNNDPLYGGTIKIPLLTAFNNTSKFKIRIYYAANHNYNHDYIGALLTINSQHVANFKFKQTFSGED
YSNLSYNNYQFDYLVQTVAFPQNTSDVTLNLQFFYDPKFLNDYKQIVIIDKIEFIPEN
| 138996 | Cry17Aa1 | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1006/jipa.2001.5042 | | Larvae | 2nd instar | | Addition to water | Cry17Aa1 could only be produced in the presence of Cry16Aa1 (also non-toxic) | Colin Berry | 2025-09-04 |
| 961 | MNNKKIEQNKIVEYNSNLDIQPRELNTLNGLVFTGATVSIILPLIGTTAVVPVVGGVIGIIAALLPVIWPAGTSSNDNLF
DAVMKDTEMIMDEKISEYVVNDAMTRLESLYNILDYYRLSKDFWEKNKDDPLAIAELKERFSKLHSQFIESMAYFKRANY
EVLLLPAYANAANLHLLLLREGLLLNKVIDNFITEGLHYEEFKTKRSTYIAHCSTWYNKGLENIKNKTRDFNKINKYDAY
MNLSVLDIISLFLSYDPYQYDKATKLQTLTRTVFSDPLQRAPRDLYISPKEETLFKNLKGLRAFFAEGDLVLTGFRNYFR
NTYINDQIIEGDLFGYTTNNERYKLFTDSKIYKVTVFIDNVALAIVKLIFHDTDNKEWDFSKTDITDINKYRKEEVYLNL
LSNNEIQKEPSHYLYKMHHYGDNYNDSYLFQWIHQSISPENYLFDKDKDDNYIITQIPAIKASELSNLGELSLQAIKGPR
FTGGNVILSSVSKIDNNDPLYGGTIKIPLLTAFNNTSKFKIRIYYAANHNYNHDYIGALLTINSQHVANFKFKQTFSGED
YSNLSYNNYQFDYLVQTVAFPQNTSDVTLNLQFFYDPKFLNDYKQIVIIDKIEFIPEN
| 129545 | Cry17Aa1 | No | Not applicable | Diptera | Anopheles stephensi | No | 30069 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/s0378-1119(98)00122-x | | Larvae | 2nd Instar | Other (add to comments) | Addition to water | Proteins TCA extracted from culture supernatants Low non-calculable activity reported >100µg in 2ml | Colin Berry | 2024-06-13 |
| 962 | MNNKKIEQNKIVEYNSNLDIQPRELNTLNGLVFTGATVSIILPLIGTTAVVPVVGGVIGIIAALLPVIWPAGTSSNDNLF
DAVMKDTEMIMDEKISEYVVNDAMTRLESLYNILDYYRLSKDFWEKNKDDPLAIAELKERFSKLHSQFIESMAYFKRANY
EVLLLPAYANAANLHLLLLREGLLLNKVIDNFITEGLHYEEFKTKRSTYIAHCSTWYNKGLENIKNKTRDFNKINKYDAY
MNLSVLDIISLFLSYDPYQYDKATKLQTLTRTVFSDPLQRAPRDLYISPKEETLFKNLKGLRAFFAEGDLVLTGFRNYFR
NTYINDQIIEGDLFGYTTNNERYKLFTDSKIYKVTVFIDNVALAIVKLIFHDTDNKEWDFSKTDITDINKYRKEEVYLNL
LSNNEIQKEPSHYLYKMHHYGDNYNDSYLFQWIHQSISPENYLFDKDKDDNYIITQIPAIKASELSNLGELSLQAIKGPR
FTGGNVILSSVSKIDNNDPLYGGTIKIPLLTAFNNTSKFKIRIYYAANHNYNHDYIGALLTINSQHVANFKFKQTFSGED
YSNLSYNNYQFDYLVQTVAFPQNTSDVTLNLQFFYDPKFLNDYKQIVIIDKIEFIPEN
| 129544 | Cry17Aa1 | No | Not applicable | Diptera | Aedes aegypti | No | 7159 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/s0378-1119(98)00122-x | | Larvae | 2nd Instar | Other (add to comments) | Addition to water | Proteins TCA extracted from culture supernatants Low non-calculable activity reported >100µg in 2ml | Colin Berry | 2024-06-13 |
| 963 | MNNKKIEQNKIVEYNSNLDIQPRELNTLNGLVFTGATVSIILPLIGTTAVVPVVGGVIGIIAALLPVIWPAGTSSNDNLF
DAVMKDTEMIMDEKISEYVVNDAMTRLESLYNILDYYRLSKDFWEKNKDDPLAIAELKERFSKLHSQFIESMAYFKRANY
EVLLLPAYANAANLHLLLLREGLLLNKVIDNFITEGLHYEEFKTKRSTYIAHCSTWYNKGLENIKNKTRDFNKINKYDAY
MNLSVLDIISLFLSYDPYQYDKATKLQTLTRTVFSDPLQRAPRDLYISPKEETLFKNLKGLRAFFAEGDLVLTGFRNYFR
NTYINDQIIEGDLFGYTTNNERYKLFTDSKIYKVTVFIDNVALAIVKLIFHDTDNKEWDFSKTDITDINKYRKEEVYLNL
LSNNEIQKEPSHYLYKMHHYGDNYNDSYLFQWIHQSISPENYLFDKDKDDNYIITQIPAIKASELSNLGELSLQAIKGPR
FTGGNVILSSVSKIDNNDPLYGGTIKIPLLTAFNNTSKFKIRIYYAANHNYNHDYIGALLTINSQHVANFKFKQTFSGED
YSNLSYNNYQFDYLVQTVAFPQNTSDVTLNLQFFYDPKFLNDYKQIVIIDKIEFIPEN
| 138998 | Cry17Aa1 | No | Not applicable | Diptera | Anopheles gambiae | No | 7165 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1006/jipa.2001.5042 | | Larvae | 2nd instar | | Addition to water | Cry17Aa1 could only be produced in the presence of Cry16Aa1 (also non-toxic) | Colin Berry | 2025-09-04 |
| 964 | MNNKKIEQNKIVEYNSNLDIQPRELNTLNGLVFTGATVSIILPLIGTTAVVPVVGGVIGIIAALLPVIWPAGTSSNDNLF
DAVMKDTEMIMDEKISEYVVNDAMTRLESLYNILDYYRLSKDFWEKNKDDPLAIAELKERFSKLHSQFIESMAYFKRANY
EVLLLPAYANAANLHLLLLREGLLLNKVIDNFITEGLHYEEFKTKRSTYIAHCSTWYNKGLENIKNKTRDFNKINKYDAY
MNLSVLDIISLFLSYDPYQYDKATKLQTLTRTVFSDPLQRAPRDLYISPKEETLFKNLKGLRAFFAEGDLVLTGFRNYFR
NTYINDQIIEGDLFGYTTNNERYKLFTDSKIYKVTVFIDNVALAIVKLIFHDTDNKEWDFSKTDITDINKYRKEEVYLNL
LSNNEIQKEPSHYLYKMHHYGDNYNDSYLFQWIHQSISPENYLFDKDKDDNYIITQIPAIKASELSNLGELSLQAIKGPR
FTGGNVILSSVSKIDNNDPLYGGTIKIPLLTAFNNTSKFKIRIYYAANHNYNHDYIGALLTINSQHVANFKFKQTFSGED
YSNLSYNNYQFDYLVQTVAFPQNTSDVTLNLQFFYDPKFLNDYKQIVIIDKIEFIPEN
| 138997 | Cry17Aa1 | No | Not applicable | Diptera | Culex pipiens | No | 7175 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1006/jipa.2001.5042 | | Larvae | 2nd instar | | Addition to water | Cry17Aa1 could only be produced in the presence of Cry16Aa1 (also non-toxic) | Colin Berry | 2025-09-04 |
| 965 | | 47432 | Cry19A | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 1680 | ng/ml | | | 10.1603/0022-2585-41.3.435 | | Larvae | 4th instar | Spore crystal mix | addition to water | | Jakub Baranek | 2024-03-22 |
| 966 | | 138171 | Cry19A1 | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | | | | | 10.1128/AEM.06750-11 | | Larvae | 4th instar | Spore crystal mix | Addition to water | Toxicity when fused to the downstream crystallisation domain region but not when expressed alone, probably due to low accumulation of the unfused protein | Colin Berry | 2025-09-04 |
| 967 | | 129550 | Cry19Aa | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 35 | ng/ml | | | 10.1128/AEM.70.6.3769-3771.2004 | | Larvae | | | Addition to water | 2 day old larvae | Colin Berry | 2024-06-13 |
| 968 | | 129547 | Cry19Aa | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 1.4x10(5) | ng/ml | | | 10.1128/AEM.70.6.3769-3771.2004 | | Larvae | | | Addition to water | 2 day old larvae | Colin Berry | 2024-06-13 |
| 969 | | 129548 | Cry19Aa | No | Not applicable | Diptera | Anopheles quadrimaculatus | Yes | 7166 | 3 | ng/ml | | | 10.1128/AEM.70.6.3769-3771.2004 | | Larvae | | | Addition to water | 3 day old larvae | Colin Berry | 2024-06-13 |
| 970 | | 129549 | Cry19Aa | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 6 | ng/ml | | | 10.1128/AEM.70.6.3769-3771.2004 | | Larvae | | | Addition to water | 2 day old larvae | Colin Berry | 2024-06-13 |
| 971 | | 129551 | Cry19Aa mutant L1L2 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | 3.3 | ng/ml | | | 10.1128/AEM.70.6.3769-3771.2004 | | Larvae | | | Addition to water | 2 day old larvae | Colin Berry | 2024-06-13 |
| 972 | | 129552 | Cry19Aa mutant L1L3 | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 5 | ng/ml | | | 10.1128/AEM.70.6.3769-3771.2004 | | Larvae | | | Addition to water | 2 day old larvae | Colin Berry | 2024-06-13 |
| 973 | | 129553 | Cry19Aa mutant L1L4 | No | Not applicable | Diptera | Culex quinquefasciatus | Yes | 7176 | 19 | ng/ml | | | 10.1128/AEM.70.6.3769-3771.2004 | | Larvae | | | Addition to water | 2 day old larvae | Colin Berry | 2024-06-13 |
| 974 | | 129554 | Cry19Aa mutant L1L5 | No | Not applicable | Diptera | Anopheles quadrimaculatus | Yes | 7166 | 2.2 | ng/ml | | | 10.1128/AEM.70.6.3769-3771.2004 | | Larvae | | | Addition to water | 3 day old larvae | Colin Berry | 2024-06-13 |
| 975 | MHYYGNRNEYDILNASSNDSNMSNTYPRYPLANPQQDLMQNTNYKDWLNVCEGYHIENPREASVRAGLGKGLGIVSTIVG
FFGGSIILDTIGLFYQISELLWPEDDTQQYTWQDIMNHVEDLIDKRITEVIRGNAIRTLADLQGKVDDYNNWLKKWKDDP
KSTGNLSTLVTKFTALDSDFNGAIRTVNNQGSPGYELLLLPVYAQIANLHLLLLRDAQIYGDKWWSARANARDNYYQIQL
EKTKEYTEYCINWYNKGLNDFRTAGQWVNFNRYRREMTLTVLDIISMFPIYDARLYPTEVKTELTREIYSDVINGEIYGL
MTPYFSFEKAESLYTRAPHLFTWLKGFRFVTNSISYWTFLSGGQNKYSYTNNSSINEGSFRGQDTDYGGTSSTINIPSNS
YVYNLWTENYEYIYPWGDPVNITKMNFSVTDNNSSKELIYGAHRTNKPVVRTDFDFLTNKEGTELAKYNDYNHILSYMLI
NGETFGQKRHGYSFAFTHSSVDPNNTIAANKITQIPVVKASSINGSISIEKGPGFTGGDLVKMRADSGLTMRFKAELLDK
KYRVRIRYKCNYSSKLILRKWKGEGYIQQQIHNISPTYGAFSYLESFTITTTENIFDLTMEVTYPYGRQFVEDIPSLILD
KIEFLPTN
| 47238 | Cry19Aa1 | No | Not applicable | Diptera | Anopheles stephensi | Yes | 30069 | 1.04 | µg/ml | | | 10.1128/aem.63.11.4449-4455.1997 | | Larvae | 2nd Instar | Purified protein | Addition to water | | Alexander Wall | 2024-09-09 |
| 976 | MHYYGNRNEYDILNASSNDSNMSNTYPRYPLANPQQDLMQNTNYKDWLNVCEGYHIENPREASVRAGLGKGLGIVSTIVG
FFGGSIILDTIGLFYQISELLWPEDDTQQYTWQDIMNHVEDLIDKRITEVIRGNAIRTLADLQGKVDDYNNWLKKWKDDP
KSTGNLSTLVTKFTALDSDFNGAIRTVNNQGSPGYELLLLPVYAQIANLHLLLLRDAQIYGDKWWSARANARDNYYQIQL
EKTKEYTEYCINWYNKGLNDFRTAGQWVNFNRYRREMTLTVLDIISMFPIYDARLYPTEVKTELTREIYSDVINGEIYGL
MTPYFSFEKAESLYTRAPHLFTWLKGFRFVTNSISYWTFLSGGQNKYSYTNNSSINEGSFRGQDTDYGGTSSTINIPSNS
YVYNLWTENYEYIYPWGDPVNITKMNFSVTDNNSSKELIYGAHRTNKPVVRTDFDFLTNKEGTELAKYNDYNHILSYMLI
NGETFGQKRHGYSFAFTHSSVDPNNTIAANKITQIPVVKASSINGSISIEKGPGFTGGDLVKMRADSGLTMRFKAELLDK
KYRVRIRYKCNYSSKLILRKWKGEGYIQQQIHNISPTYGAFSYLESFTITTTENIFDLTMEVTYPYGRQFVEDIPSLILD
KIEFLPTN
| 47239 | Cry19Aa1 | No | Not applicable | Diptera | Culex pipiens | Yes | 7175 | 0.19 | µg/ml | | | 10.1128/aem.63.11.4449-4455.1997 | | Larvae | 4th Instar | Purified protein | Addition to water | | Alexander Wall | 2024-10-09 |
| 977 | MNSYQNKNEYEILDAKRNTCHMSNCYPKYPLANDPQMYLRNTHYKDWINMCEEASYASSGPSQLFKVGGSIVAKILGMIP
EVGPLLSWMVSLFWPTIEEKNTVWEDMIKYVANLLKQELTNDTLNRATSNLSGLNESLNIYNRALAAWKQNKNNFASGEL
IRSYINDLHILFTRDIQSDFSLGGYETVLLPSYASAANLHLLLLRDVAIYGKELGYPSTDVEFYYNEQKYYTEKYSNYCV
NTYKSGLESKKQIGWSDFNRYRREMTLSVLDIVALFPLYDTGLYPSKDGKIHVKAELTREIYSDVINDHVYGLMVPYISF
EHAESLYTRRPHAFTWLKGFRFVTNSINSWTFLSGGENRYFLTHGEGTIYNGPFLGQDTEYGGTSSYIDISNNSSIYNLW
TKNYEWIYPWTDPVNITKINFSITDNSNSSESIYGAERMNKPTVRTDFNFLLNRAGNGPTTYNDYNHILSYMLINGETFG
QKRHGYSFAFTHSSVDRYNTIVPDKIVQIPAVKTNLVGANIIKGPGHTGGDLLKLEYERFLSLRIKLIASMTFRIRIRYA
SNISGQMMINIGYQNPTYFNIIPTTSRDYTELKFEDFQLVDTSYIYSGGPSISSNTLWLDNFSNGPVIIDKIEFIPLGIT
LNQAQGYDTYDQNANGMYHQNYSNSGYNYNQEYNTYYQSYNN
| 46738 | Cry19Ba1 | No | Not applicable | Diptera | Culex pipiens molestus | Yes | 233155 | 5.93 | µg/ml | | | 10.1016/S0723-2020(98)80022-2 | | Larvae | Not specified | Purified protein | Addition to water | | Alexander Wall | 2024-04-27 |
| 978 | MEEKELHSYYENFENITSPLVDTTNNIETVLNETDLTIQEYNCD
RDDSFELDGIPFSQLIQNIANNPDRLIHMSDIPAVLRSGESFHNGYLVTDIQPTPRIP
ALLLTWATKLTGQAIATWVAKTTATFILNQGLKQIFNILFPGLGSVTMDEVLKEVEQL
FNRKFSEITKNALQQEYVGFIAVVDDLVKTIDIASTQRTLTYDLRDTLRIRLLAADTL
FKQRMPVFNVKGYEELALPFYAMMGTLHLTILKTAIIGGQEWGFDAQTLQLFKTEIDR
ATSVYTDTAVQMYAAAIKNATTTQQKKSNELIDLMTTLRISAMDQVYYWGLFKVQGIP
YTLSRSLWYATALDESNKKLPESEYSRFYRVLVSPLNGAIDQLQYKPNESIPHNWYSA
IKMIPFNNSPQLSRTSSETTPAQLTGNFRKIVPVMGIMDGSMNPSILPNRIITNLFGV
DAVRESINGIGYYYNNTLIGGVGSDSNYDNISFPDTTLKAILLNSVTSYPNFQSIADI
IQYNSPRYAWPANLIFSFTPTDTMAFNRDGYHLPKQGETSMVIPARQFNTITEDKSYV
ITDVPHAGTDGAIKLTNGAEATYSVKAPVSENTNTRYVLLIERTSDSTGAVRYYPNPD
FPGVSIQLNSQGSISPNLAGQYLTKYDAFKFNQAYAYNSIKGGVIKITADANGWFQYT NIYIVKESDFKALW
| 129696 | Cry1A.105 | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | 0.006-0.401 | µg/ml | | | 10.3390/toxins15100602 | | Larvae | 1st Instar | Purified protein | Other | Range of susceptibilities measured in different field populations. Diet dip assay used. | Colin Berry | 2024-06-13 |
| 979 | MEEKELHSYYENFENITSPLVDTTNNIETVLNETDLTIQEYNCD
RDDSFELDGIPFSQLIQNIANNPDRLIHMSDIPAVLRSGESFHNGYLVTDIQPTPRIP
ALLLTWATKLTGQAIATWVAKTTATFILNQGLKQIFNILFPGLGSVTMDEVLKEVEQL
FNRKFSEITKNALQQEYVGFIAVVDDLVKTIDIASTQRTLTYDLRDTLRIRLLAADTL
FKQRMPVFNVKGYEELALPFYAMMGTLHLTILKTAIIGGQEWGFDAQTLQLFKTEIDR
ATSVYTDTAVQMYAAAIKNATTTQQKKSNELIDLMTTLRISAMDQVYYWGLFKVQGIP
YTLSRSLWYATALDESNKKLPESEYSRFYRVLVSPLNGAIDQLQYKPNESIPHNWYSA
IKMIPFNNSPQLSRTSSETTPAQLTGNFRKIVPVMGIMDGSMNPSILPNRIITNLFGV
DAVRESINGIGYYYNNTLIGGVGSDSNYDNISFPDTTLKAILLNSVTSYPNFQSIADI
IQYNSPRYAWPANLIFSFTPTDTMAFNRDGYHLPKQGETSMVIPARQFNTITEDKSYV
ITDVPHAGTDGAIKLTNGAEATYSVKAPVSENTNTRYVLLIERTSDSTGAVRYYPNPD
FPGVSIQLNSQGSISPNLAGQYLTKYDAFKFNQAYAYNSIKGGVIKITADANGWFQYT NIYIVKESDFKALW
| 47330 | Cry1A.105 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | 0.6 | ng/cm2 | | | 10.1371/journal.pone.0068164 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Neil Crickmore | 2024-10-12 |
| 980 | MEEKELHSYYENFENITSPLVDTTNNIETVLNETDLTIQEYNCD
RDDSFELDGIPFSQLIQNIANNPDRLIHMSDIPAVLRSGESFHNGYLVTDIQPTPRIP
ALLLTWATKLTGQAIATWVAKTTATFILNQGLKQIFNILFPGLGSVTMDEVLKEVEQL
FNRKFSEITKNALQQEYVGFIAVVDDLVKTIDIASTQRTLTYDLRDTLRIRLLAADTL
FKQRMPVFNVKGYEELALPFYAMMGTLHLTILKTAIIGGQEWGFDAQTLQLFKTEIDR
ATSVYTDTAVQMYAAAIKNATTTQQKKSNELIDLMTTLRISAMDQVYYWGLFKVQGIP
YTLSRSLWYATALDESNKKLPESEYSRFYRVLVSPLNGAIDQLQYKPNESIPHNWYSA
IKMIPFNNSPQLSRTSSETTPAQLTGNFRKIVPVMGIMDGSMNPSILPNRIITNLFGV
DAVRESINGIGYYYNNTLIGGVGSDSNYDNISFPDTTLKAILLNSVTSYPNFQSIADI
IQYNSPRYAWPANLIFSFTPTDTMAFNRDGYHLPKQGETSMVIPARQFNTITEDKSYV
ITDVPHAGTDGAIKLTNGAEATYSVKAPVSENTNTRYVLLIERTSDSTGAVRYYPNPD
FPGVSIQLNSQGSISPNLAGQYLTKYDAFKFNQAYAYNSIKGGVIKITADANGWFQYT NIYIVKESDFKALW
| 137987 | Cry1A.105 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | 3.2 to 5.8 | ng/ml | | | 10.1016/j.yrtph.2018.09.003 | | Larvae | | | | Synthetic Cry1 chimera | Colin Berry | 2025-09-04 |
| 981 | MEEKELHSYYENFENITSPLVDTTNNIETVLNETDLTIQEYNCD
RDDSFELDGIPFSQLIQNIANNPDRLIHMSDIPAVLRSGESFHNGYLVTDIQPTPRIP
ALLLTWATKLTGQAIATWVAKTTATFILNQGLKQIFNILFPGLGSVTMDEVLKEVEQL
FNRKFSEITKNALQQEYVGFIAVVDDLVKTIDIASTQRTLTYDLRDTLRIRLLAADTL
FKQRMPVFNVKGYEELALPFYAMMGTLHLTILKTAIIGGQEWGFDAQTLQLFKTEIDR
ATSVYTDTAVQMYAAAIKNATTTQQKKSNELIDLMTTLRISAMDQVYYWGLFKVQGIP
YTLSRSLWYATALDESNKKLPESEYSRFYRVLVSPLNGAIDQLQYKPNESIPHNWYSA
IKMIPFNNSPQLSRTSSETTPAQLTGNFRKIVPVMGIMDGSMNPSILPNRIITNLFGV
DAVRESINGIGYYYNNTLIGGVGSDSNYDNISFPDTTLKAILLNSVTSYPNFQSIADI
IQYNSPRYAWPANLIFSFTPTDTMAFNRDGYHLPKQGETSMVIPARQFNTITEDKSYV
ITDVPHAGTDGAIKLTNGAEATYSVKAPVSENTNTRYVLLIERTSDSTGAVRYYPNPD
FPGVSIQLNSQGSISPNLAGQYLTKYDAFKFNQAYAYNSIKGGVIKITADANGWFQYT NIYIVKESDFKALW
| 47331 | Cry1A.105 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 400 | ng/cm2 | | | 10.1371/journal.pone.0068164 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Neil Crickmore | 2024-11-12 |
| 982 | MEEKELHSYYENFENITSPLVDTTNNIETVLNETDLTIQEYNCD
RDDSFELDGIPFSQLIQNIANNPDRLIHMSDIPAVLRSGESFHNGYLVTDIQPTPRIP
ALLLTWATKLTGQAIATWVAKTTATFILNQGLKQIFNILFPGLGSVTMDEVLKEVEQL
FNRKFSEITKNALQQEYVGFIAVVDDLVKTIDIASTQRTLTYDLRDTLRIRLLAADTL
FKQRMPVFNVKGYEELALPFYAMMGTLHLTILKTAIIGGQEWGFDAQTLQLFKTEIDR
ATSVYTDTAVQMYAAAIKNATTTQQKKSNELIDLMTTLRISAMDQVYYWGLFKVQGIP
YTLSRSLWYATALDESNKKLPESEYSRFYRVLVSPLNGAIDQLQYKPNESIPHNWYSA
IKMIPFNNSPQLSRTSSETTPAQLTGNFRKIVPVMGIMDGSMNPSILPNRIITNLFGV
DAVRESINGIGYYYNNTLIGGVGSDSNYDNISFPDTTLKAILLNSVTSYPNFQSIADI
IQYNSPRYAWPANLIFSFTPTDTMAFNRDGYHLPKQGETSMVIPARQFNTITEDKSYV
ITDVPHAGTDGAIKLTNGAEATYSVKAPVSENTNTRYVLLIERTSDSTGAVRYYPNPD
FPGVSIQLNSQGSISPNLAGQYLTKYDAFKFNQAYAYNSIKGGVIKITADANGWFQYT NIYIVKESDFKALW
| 46213 | Cry1A.105 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 2.77 | µg/g | | | 10.1002/ps.4644 | | Larvae | 1st Instar | Purified protein | Diet incorporation | | Chloe Tucker | 2022-11-19 |
| 983 | MEEKELHSYYENFENITSPLVDTTNNIETVLNETDLTIQEYNCD
RDDSFELDGIPFSQLIQNIANNPDRLIHMSDIPAVLRSGESFHNGYLVTDIQPTPRIP
ALLLTWATKLTGQAIATWVAKTTATFILNQGLKQIFNILFPGLGSVTMDEVLKEVEQL
FNRKFSEITKNALQQEYVGFIAVVDDLVKTIDIASTQRTLTYDLRDTLRIRLLAADTL
FKQRMPVFNVKGYEELALPFYAMMGTLHLTILKTAIIGGQEWGFDAQTLQLFKTEIDR
ATSVYTDTAVQMYAAAIKNATTTQQKKSNELIDLMTTLRISAMDQVYYWGLFKVQGIP
YTLSRSLWYATALDESNKKLPESEYSRFYRVLVSPLNGAIDQLQYKPNESIPHNWYSA
IKMIPFNNSPQLSRTSSETTPAQLTGNFRKIVPVMGIMDGSMNPSILPNRIITNLFGV
DAVRESINGIGYYYNNTLIGGVGSDSNYDNISFPDTTLKAILLNSVTSYPNFQSIADI
IQYNSPRYAWPANLIFSFTPTDTMAFNRDGYHLPKQGETSMVIPARQFNTITEDKSYV
ITDVPHAGTDGAIKLTNGAEATYSVKAPVSENTNTRYVLLIERTSDSTGAVRYYPNPD
FPGVSIQLNSQGSISPNLAGQYLTKYDAFKFNQAYAYNSIKGGVIKITADANGWFQYT NIYIVKESDFKALW
| 47367 | Cry1A.105 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 0.241 | ng/cm2 | | | 10.1371/journal.pone.0154492 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Chloe Tucker | 2024-01-16 |
| 984 | MEEKELHSYYENFENITSPLVDTTNNIETVLNETDLTIQEYNCD
RDDSFELDGIPFSQLIQNIANNPDRLIHMSDIPAVLRSGESFHNGYLVTDIQPTPRIP
ALLLTWATKLTGQAIATWVAKTTATFILNQGLKQIFNILFPGLGSVTMDEVLKEVEQL
FNRKFSEITKNALQQEYVGFIAVVDDLVKTIDIASTQRTLTYDLRDTLRIRLLAADTL
FKQRMPVFNVKGYEELALPFYAMMGTLHLTILKTAIIGGQEWGFDAQTLQLFKTEIDR
ATSVYTDTAVQMYAAAIKNATTTQQKKSNELIDLMTTLRISAMDQVYYWGLFKVQGIP
YTLSRSLWYATALDESNKKLPESEYSRFYRVLVSPLNGAIDQLQYKPNESIPHNWYSA
IKMIPFNNSPQLSRTSSETTPAQLTGNFRKIVPVMGIMDGSMNPSILPNRIITNLFGV
DAVRESINGIGYYYNNTLIGGVGSDSNYDNISFPDTTLKAILLNSVTSYPNFQSIADI
IQYNSPRYAWPANLIFSFTPTDTMAFNRDGYHLPKQGETSMVIPARQFNTITEDKSYV
ITDVPHAGTDGAIKLTNGAEATYSVKAPVSENTNTRYVLLIERTSDSTGAVRYYPNPD
FPGVSIQLNSQGSISPNLAGQYLTKYDAFKFNQAYAYNSIKGGVIKITADANGWFQYT NIYIVKESDFKALW
| 47481 | Cry1A.105 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 201.9 | ng/cm2 | | | 10.3390/insects11120831 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Chloe Tucker | 2024-10-05 |
| 985 | | 47394 | Cry1A.2 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | greater than 6,896.6 | ng/cm2 | | | 10.1371/journal.pone.0249150 | | larvae | 1st Instar | | Diet incorporation | | Victoria Valby | 2024-12-02 |
| 986 | | 47397 | Cry1A.2 | No | Not applicable | Lepidoptera | Spodoptera eridania | Yes | 37547 | 14.51 | ng/cm2 | | | 10.1371/journal.pone.0249150 | | larvae | 1st Instar | | Diet incorporation | | Victoria Valby | 2024-02-15 |
| 987 | | 47393 | Cry1A.2 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | 11.72 | ng/cm2 | | | 10.1371/journal.pone.0249150 | | larvae | 1st Instar | | Diet incorporation | | Victoria Valby | 2024-11-02 |
| 988 | | 47392 | Cry1A.2 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | 5 | ng/cm2 | | | 10.1371/journal.pone.0249150 | | larvae | 1st Instar | | Diet incorporation | | Victoria Valby | 2024-10-02 |
| 989 | | 47396 | Cry1A.2 | No | Not applicable | Lepidoptera | Spodoptera cosmioides | Yes | 134402 | 12.26 | ng/cm2 | | | 10.1371/journal.pone.0249150 | | larvae | 1st Instar | | Diet incorporation | | Victoria Valby | 2024-02-14 |
| 990 | | 47395 | Cry1A.2 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | greater than 6,896.5 | ng/cm2 | | | 10.1371/journal.pone.0249150 | | larvae | 1st Instar | | Diet incorporation | | Victoria Valby | 2024-02-13 |
| 991 | | 129709 | Cry1Aa | No | Not applicable | Lepidoptera | Lymantria dispar | Yes | 13123 | 56.2 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 992 | | 138907 | Cry1Aa | No | Not applicable | Lepidoptera | Cydia pomonella | Yes | 82600 | 23 | ng/g | | | 10.1016/j.jip.2006.01.004 | | Larvae | 1st instar | Purified protein | Diet incorporation | Trypsin activated toxin LC50 given: solubilised protoxins have higher LC50 | Colin Berry | 2025-09-04 |
| 993 | | 137992 | Cry1Aa | No | Not applicable | Lepidoptera | Earias vittella | Yes | 1372994 | 0.599 | ng/cm2 | | | 10.1016/S0261-2194(99)00058-7 | | Larvae | 1st instar | Purified protein | Leaf dip | Mean LC50 presented with some variation depending on region of origin of larvae | Colin Berry | 2025-09-04 |
| 994 | | 47412 | Cry1Aa | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | 1.8 | ng/cm2 | | | 10.1590/S0100-204X2014000200001 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-02-03 |
| 995 | | 47046 | Cry1Aa | No | Not applicable | Lepidoptera | Chilo partellus | Yes | 236792 | 83.46 | ng/cm2 | | | 10.1111/j.1472-765X.2010.02856.x | | Larvae | 4th instar | Purified protein | surface contamination | | Jakub Baranek | 2024-01-03 |
| 996 | | 46503 | Cry1Aa | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 9080 | ng/g | | | 10.1016/j.jip.2010.05.002 | | unknown | | Purified protein | diet incorporation | | Jakub Baranek | 2023-05-09 |
| 997 | | 47066 | Cry1Aa | No | Not applicable | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | 10.8 | ng/larva | | | 10.1111/j.1574-6968.2002.tb11378.x | | Larvae | 6th instar | Purified crystals | droplet feeding | Results expressed as EC50 in ng toxin per larva | Jakub Baranek | 2024-03-21 |
| 998 | | 47413 | Cry1Aa | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | 27 | ng/cm2 | | | 10.1590/S0100-204X2014000200001 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-03-03 |
| 999 | | 47540 | Cry1Aa | No | Not applicable | Lepidoptera | Diatraea flavipennella | Yes | 1813784 | 106 | ng/cm2 | | | 10.7717/peerj.2866 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-08-07 |
| 1000 | | 47541 | Cry1Aa | No | Not applicable | Lepidoptera | Elasmopalpus lignosellus | Yes | 1511197 | 73.6 | ng/cm2 | | | 10.7717/peerj.2866 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-09-07 |
| 1001 | | 46403 | Cry1Aa | No | Not applicable | Lepidoptera | Ephestia kuehniella | Yes | 40079 | greater than 4000 | ng/mg | | | 10.1016/j.biocontrol.2005.06.009 | | Larvae | 3rd instar | Spore crystal mix | diet incorporation | | Jakub Baranek | 2023-05-28 |
| 1002 | | 46470 | Cry1Aa | No | Not applicable | Lepidoptera | Epinotia aporema | Yes | 437486 | 4140 | ng/ml | | | 10.1016/j.jip.2006.09.002 | | Larvae | 1st instar | Purified crystals | diet incorporation | | Jakub Baranek | 2023-03-08 |
| 1003 | | 46595 | Cry1Aa | No | Not applicable | Lepidoptera | Grapholita molesta | Yes | 192188 | 7.5 | ng/cm2 | | | 10.1016/j.jip.2016.09.006 | | Larvae | 1st Instar | Purified crystals | surface contamination | | Jakub Baranek | 2023-06-12 |
| 1004 | | 46568 | Cry1Aa | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 11.99 | ng/larva | | | 10.1016/j.jip.2014.06.005 | | Larvae | 1st Instar | Purified crystals | droplet feeding | | Jakub Baranek | 2023-09-11 |
| 1005 | | 47038 | Cry1Aa | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 338000 | ng/ml | | | 10.1111/j.1472-765X.2005.01712.x | | Larvae | 1st instar | Spore crystal mix | diet incorporation | | Jakub Baranek | 2024-02-21 |
| 1006 | | 47348 | Cry1Aa | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | 3500 | ng/cm2 | | | 10.1371/journal.pone.0107196 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-12-28 |
| 1007 | | 47229 | Cry1Aa | No | Not applicable | Lepidoptera | Lymantria dispar | Yes | 13123 | 106 | ng/larva | | | 10.1128/AEM.62.2.583-586.1996 | | Larvae | 4th instar | Purified crystals | force feeding | | Jakub Baranek | 2024-08-31 |
| 1008 | | 46504 | Cry1Aa | No | Not applicable | Lepidoptera | Sesamia inferens | Yes | 492764 | 32900 | ng/g | | | 10.1016/j.jip.2010.05.002 | | unknown | | Purified protein | diet incorporation | | Jakub Baranek | 2023-06-09 |
| 1009 | | 47039 | Cry1Aa | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 3936000 | ng/ml | | | 10.1111/j.1472-765X.2005.01712.x | | Larvae | 1st instar | Spore crystal mix | diet incorporation | | Jakub Baranek | 2024-02-22 |
| 1010 | | 138211 | Cry1Aa | No | Not applicable | Lepidoptera | Scirpophaga incertulas | Yes | 72366 | 1.32 | ng/ml | | | 10.1128/aem.63.4.1453-1459.1997 | | | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1011 | | 138215 | Cry1Aa | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 1422.4 | ng/ml | | | 10.1128/aem.63.4.1453-1459.1997 | | | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1012 | | 46228 | Cry1Aa | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 4109 | ng/cm2 | | | 10.1002/ps.6157 | | larvae | 2-3 day old | Purified protein | Surface contamination | | Neil Crickmore | 2022-04-12 |
| 1013 | | 137780 | Cry1Aa | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | 1400 | ng/cm2 | | | 10.1007/s00203-003-0543-6 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1014 | | 47359 | Cry1Aa | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 73 | ng/cm2 | | | 10.1371/journal.pone.0119544 | | Larvae | 2nd Instar | Spore crystal mix | Surface contamination | | Chloe Tucker | 2024-08-01 |
| 1015 | | 48979 | Cry1Aa | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.72 | | | | 10.1186/s12915-022-01226-1 | | Larvae | 3rd Instar | Purified protein | Leaf-dip | | Leopoldo Palma | 2023-04-21 |
| 1016 | | 48934 | Cry1Aa | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 2.8 | mg/l | | | 10.1128/AEM.67.7.3216-3219.2001 | | Larvae | 3rd Instar | Purified protein | Leaf-dip | Use of resistant insects and different generations resistance is also described in the work | Jorge Zimmermann | 2023-04-21 |
| 1017 | | 49725 | Cry1Aa | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 98% mortality at 100 µg/ml | 10.1074/jbc.274.45.31996 | | Larvae | 3rd Instar | Purified protein | Leaf-dip | | Jorge Zimmermann | 2023-04-21 |
| 1018 | | 137815 | Cry1Aa | No | Not applicable | Lepidoptera | Cnaphalocrocis medinalis | Yes | 437488 | 170.01 | ng/cm2 | | | 10.1007/s002840010134 | | Larvae | | | Leaf dip | Three day old larvae used | Colin Berry | 2025-09-04 |
| 1019 | | 137819 | Cry1Aa | No | Not applicable | Lepidoptera | Cnaphalocrocis patnalis | Yes | 1591229 | 235.23 | ng/cm2 | | | 10.1007/s002840010134 | | Larvae | | | Leaf dip | Three day old larvae used. Insect described using synonym Marasmia patnalis | Colin Berry | 2025-09-04 |
| 1020 | | 129697 | Cry1Aa | No | Not applicable | Lepidoptera | Tecia solanivora | Yes | 396680 | 0.103 | µg/cm2 | | | Rev. colomb. biotecnol [online]. 2008, vol.10, n.2, pp.85-96. | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-19 |
| 1021 | | 129719 | Cry1Aa | No | Not applicable | Lepidoptera | Thaumetopoea pityocampa | Yes | 208016 | 956 | pg/µl | | | 10.1128/AEM.66.4.1553-1558.2000 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-23 |
| 1022 | | 129718 | Cry1Aa | No | Not applicable | Lepidoptera | Thaumetopoea pityocampa | Yes | 208016 | 956 | | | | 10.1006/pest.1999.2426 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-06-13 |
| 1023 | | 129717 | Cry1Aa | No | Not applicable | Lepidoptera | Thaumatotibia leucotreta | Yes | 463830 | 24.27 | ng | | | 10.1016/j.cropro.2011.09.019 | | Larvae | 1st instar | Other | Other (add to comments) | Droplet feeding assay using semi purified inclusion bodies from E. coli expression. LD50 values reported | Colin Berry | 2024-07-29 |
| 1024 | | 129716 | Cry1Aa | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 1.974 | µg/ml | | | 10.1007/s002849900438 | | Larvae | 2nd Instar | Purified protein | Leaf-dip | LC50 for 5 days presented (paper also has LC50 at 2 days) | Colin Berry | 2024-06-13 |
| 1025 | | 129715 | Cry1Aa | No | Not applicable | Lepidoptera | Platynota stultana | Yes | 708047 | 0.7 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1026 | | 129714 | Cry1Aa | No | Not applicable | Lepidoptera | Pandemis pyrusana | Yes | 1144657 | 1.1 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1027 | | 129713 | Cry1Aa | No | Not applicable | Lepidoptera | Orgyia leucostigma | Yes | 95259 | 52.6 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1028 | | 129712 | Cry1Aa | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 6.25 | ng total protein | | | 10.1128/aem.57.6.1650-1655.1991 | | Cultured cells | | Purified protein | Addition to cell culture | | Colin Berry | 2024-07-19 |
| 1029 | | 129711 | Cry1Aa | No | Not applicable | Lepidoptera | Malacosoma disstria | Yes | 40071 | 36.9 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1030 | | 129710 | Cry1Aa | No | Not applicable | Lepidoptera | Lymantria monacha | Yes | 78897 | | | | | 10.1128/AEM.66.4.1553-1558.2000 | | Larvae | 2nd instar | Purified protein | Surface contamination | Inhibition of molting from 2nd to 3rd instar at 200ng/cm2: no significant mortality | Colin Berry | 2024-07-23 |
| 1031 | | 138923 | Cry1Aa | No | Not applicable | Coleoptera | Anthonomus grandis | No | 7044 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.5483/bmbrep.2007.40.5.773 | | Larvae | 1st instar | Purified protein | | | Colin Berry | 2025-09-04 |
| 1032 | | 129708 | Cry1Aa | No | Not applicable | Lepidoptera | Cydia pomonella | Yes | 82600 | 0.097 | µg/ml | | | 10.1007/s002849910040 | | Larvae | 1st instar | Purified crystals | Surface contamination | | Colin Berry | 2024-06-13 |
| 1033 | | 129707 | Cry1Aa | No | Not applicable | Lepidoptera | Conopomorpha cramerella | Yes | 538958 | | | | 53-60% mortality | 10.1002/ps.927 | | | 3rd-4th instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-24 |
| 1034 | | 129706 | Cry1Aa | No | Not applicable | Lepidoptera | Cnaphalocrocis medinalis | Yes | 437488 | 1.981 | µg/ml | | | 10.3390/toxins15040275 | | Larvae | 2nd Instar | Purified protein | Leaf-dip | | Colin Berry | 2024-06-13 |
| 1035 | | 129705 | Cry1Aa | No | Not applicable | Lepidoptera | Choristoneura rosaceana | Yes | 27543 | 1.8 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1036 | | 129704 | Cry1Aa | No | Not applicable | Lepidoptera | Choristoneura pinus | Yes | 27542 | 9.2 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1037 | | 129703 | Cry1Aa | No | Not applicable | Lepidoptera | Choristoneura occidentalis | Yes | 27541 | 11.6 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1038 | | 129702 | Cry1Aa | No | Not applicable | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | 12.6 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1039 | | 129700 | Cry1Aa | No | Not applicable | Lepidoptera | Bombyx mori | Yes | 7091 | 1.6 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1040 | | 129699 | Cry1Aa | No | Not applicable | Lepidoptera | Argyrotaenia citrana | Yes | 96881 | 32 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1041 | | 129698 | Cry1Aa | No | Not applicable | Lepidoptera | Actebia fennica | No | 989868 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50: >3500 ng/larva | Colin Berry | 2024-07-19 |
| 1042 | | 46268 | Cry1Aa | No | Not applicable | Lepidoptera | Leucoptera coffeella | No | 1178041 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1007/pl00006763 | | Larvae | 1st instar | Purified activated protein | Leaf disc injection | LC50>1000µg/ml. Species described in the publication under the old name Perileucoptera coffeella | Jakub Baranek | 2023-01-13 |
| 1043 | | 137958 | Cry1Aa | No | Not applicable | Lepidoptera | Adoxophyes orana | Yes | 480707 | 378 | ng/g | | | 10.1016/j.jip.2016.06.004 | | Larvae | 1st instar | Partially purified inclusion bodies | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1044 | | 137955 | Cry1Aa | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | 43 | ng/cm2 | | | 10.1016/j.jip.2015.01.013 | | Larvae | 1st instar | Purified protein | | | Colin Berry | 2025-09-04 |
| 1045 | | 137895 | Cry1Aa | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | 10.7 | ng/cm2 | | | 10.1016/j.cropro.2011.05.009 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1046 | | 137894 | Cry1Aa | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | 5.6 | ng/cm2 | | | 10.1016/j.cropro.2011.05.009 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1047 | | 137893 | Cry1Aa | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | 9.6 | ng/cm2 | | | 10.1016/j.cropro.2011.05.009 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1048 | | 139185 | Cry1Aa | No | Not applicable | Lepidoptera | Achaea janata | Yes | 378752 | 60.11 | ng/cm2 | | | 10.1042/BJ20070054 | | Larvae | 2nd instar | Purified protein | Leaf-dip | | Colin Berry | 2025-10-14 |
| 1049 | | 139240 | Cry1Aa | No | Not applicable | Lepidoptera | Lymantria dispar | Yes | 13123 | | | | | 10.1128/AEM.67.9.3923-3927.2001 | | Larvae | 4th or 5th instar | Purified protein | Injection; force feeding; L dispar brain cells primary culture | Injection produced feeding inhibition; Forced feeding, frass feeding dose 56.2ng/larva | Colin Berry | 2025-10-14 |
| 1050 | | 49702 | Cry1Aa | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 99 % mortality at 100 mg/l | 10.1073/pnas.94.5.1640 | | Larvae | 3rd Instar | Not specified | Leaf-dip | Use of resistant insects is also described in the work | Jorge Zimmermann | 2023-04-21 |
| 1051 | | 49709 | Cry1Aa | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 96.1 % mortality at 10 mg/l | 10.1073/pnas.94.24.12780 | | Larvae | 3rd Instar | | Leaf-dip | Use of resistant insects is also described in the work; F1 larvae from single-pair hybrid crosses are use | Jorge Zimmermann | 2023-04-21 |
| 1052 | | 49715 | Cry1Aa | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 1.8 | µg/ml | | | 10.1016/S0167-4838(99)00086-2 | | Larvae | 3rd Instar | Purified crystals | Leaf-dip | | Jorge Zimmermann | 2023-04-21 |
| 1053 | | 129622 | Cry1Aa | No | Not applicable | Hemiptera | Diaphorina citri | No | 121845 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.jip.2024.108122 | | Adults | | Purified protein | Membrane feeding | Mortality not significantly different for trypsin activated protein at 500µg/ml compared to buffer control | Colin Berry | 2024-06-13 |
| 1054 | | 129623 | Cry1Aa | No | Not applicable | Hemiptera | Diaphorina citri | Yes | 121845 | | | | 50% mortality | 10.1111/1744-7917.12654 | | Nymph | 3rd Instar | Spore crystal mix | | 50% at 5 days | Colin Berry | 2023-12-18 |
| 1055 | | 46227 | Cry1Aa | No | Not applicable | Lepidoptera | Cydia pomonella | Yes | 82600 | 15 | ng/cm2 | | | 10.1002/ps.6157 | | larvae | 1st instar | Purified protein | Surface contamination | | Victoria Valby | 2022-03-12 |
| 1056 | | 129722 | Cry1Aa.105 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 48.22 | ng/cm2 | | | 10.1093/jee/toaa236 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-19 |
| 1057 | | 129720 | Cry1Aa.105 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | 0.79 | ng/cm2 | | | 10.1093/jee/toaa236 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-19 |
| 1058 | | 129721 | Cry1Aa.105 | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | 28.68 | ng/cm2 | | | 10.1093/jee/toaa236 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-19 |
| 1059 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFPVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLLAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVLPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137912 | Cry1Aa1 | No | Not applicable | Lepidoptera | Bombyx mori | Yes | 7091 | 6.79 | ppm | | | 10.1016/j.ibmb.2023.104030 | | Larvae | | Inclusion bodies | Surface contamination | | Colin Berry | 2025-09-04 |
| 1060 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFPVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLLAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVLPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129723 | Cry1Aa1 | No | Not applicable | Lepidoptera | Bombyx mori | Yes | 7091 | 1.02 | ng | | | 10.1111/j.1742-4658.2008.06634.x | | Larvae | 2nd Instar | Purified protein | Diet incorporation | | Colin Berry | 2024-06-13 |
| 1061 | | 129724 | Cry1Aa1 Y445C | No | Not applicable | Lepidoptera | Bombyx mori | Yes | 7091 | 166.85 | ng | | | 10.1111/j.1742-4658.2008.06634.x | | Larvae | 2nd Instar | Purified protein | Diet incorporation | | Colin Berry | 2024-06-13 |
| 1062 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNRITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKR
| 129725 | Cry1Aa2 | No | Not applicable | Lepidoptera | Bombyx mori | Yes | 7091 | 35 | ng/cm2 | | | 10.1042/BJ20070956 | | Larvae | 1st Instar | Other (add to comments) | Leaf-dip | Bombyx mori strain J65 (which is more susceptible than others to Cry1Ab). Inclusions assayed | Colin Berry | 2024-06-13 |
| 1063 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129727 | Cry1Aa25 | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 985 | ng/cm2 | | | 10.1127/entomologia/2020/0995 | | larvae | 1st instar | Purified protein | Surface contamination | 10 day LC50 reported here, 7 day LC50 also in publication | Colin Berry | 2024-06-13 |
| 1064 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129726 | Cry1Aa25 | No | Not applicable | Lepidoptera | Agrotis exclamationis | No | 215162 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1371/journal.pone.0283077 | | larvae | 1st instar | Purified protein | Surface contamination | LC50 >5000ng/cm2 | Colin Berry | 2024-06-13 |
| 1065 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138842 | Cry1Aa3 | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 1.69 | µg/cm2 | | | 10.1128/aem.62.8.3073-3073b.1996 | | Larvae | 2nd instar | Spore crystal mix | Surface contamination | | Colin Berry | 2025-09-04 |
| 1066 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137762 | Cry1Aa3 | No | Not applicable | Lepidoptera | Trichoplusia ni | Yes | 7111 | 8100 | ng/cm2 | | | 10.1006/jipa.2000.4946 | | Larvae | 1st instar | Purified protein | Surface contamination | Some difference in LC50 dependent on source - a Cry1Aa from PGS had LC50 420ng/cm2 | Colin Berry | 2025-09-04 |
| 1067 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 48963 | Cry1Aa3 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.16-3.82 | mg/l | | | 10.1128/AEM.67.10.4610-4613.2001 | | Larvae | 3rd Instar | Purified protein assayed against different P. xylostella isolates in different lab assays. Max and min LC50 reported here. | Leaf-dip | Protein assayed against different P. xylostella isolates in different lab assays. Max and min LC50 reported here. | Jorge Zimmermann | 2023-04-21 |
| 1068 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129701 | Cry1Aa3 | No | Not applicable | Lepidoptera | Cacyreus marshalli | Yes | 266946 | | | | | 10.1128/AEM.68.8.4090-4094.2002 | | | 3rd instar | Purified protein | Leaf dip | Growth inhibition 64% after 1mg/l leaf dip, 48h | Colin Berry | 2024-07-24 |
| 1069 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137936 | Cry1Aa3 | No | Not applicable | Lepidoptera | Helicoverpa armigera | No | 29058 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.jip.2005.04.003 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1070 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137939 | Cry1Aa3 | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 3607 to 4607 | ng/cm2 | | | 10.1016/j.jip.2007.11.001 | | Larvae | | Purified protein | Surface contamination | 2 day old larvae used. Different levels of activity seen with different S exigua colonies | Colin Berry | 2025-09-04 |
| 1071 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138658 | Cry1Aa3 | No | Not applicable | Lepidoptera | Prays oleae | Yes | 627135 | | | | 0.4 | Bulletin of Insectology (2012) 65 (1): 119-122 | | Larvae | 3rd instar | Spore crystal mix | Surface contamination | | Colin Berry | 2025-09-04 |
| 1072 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138230 | Cry1Aa3 | No | Not applicable | Lepidoptera | Pectinophora gossypiella | Yes | 13191 | | | | 1 | 10.1128/AEM.66.10.4582-4584.2000 | | Larvae | 1st instar | | Diet incorporation | Data on activity against Cry1Ac resistant strains also detailed | Colin Berry | 2025-09-04 |
| 1073 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 49700 | Cry1Aa3 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100 % mortality at 55.5 µg/ml | 10.1271/bbb.60.1483 | | Larvae | 3rd Instar | Purified crystals | Surface contamination | | Jorge Zimmermann | 2023-04-21 |
| 1074 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138258 | Cry1Aa3 | No | Not applicable | Lepidoptera | Earias insulana | Yes | 1231953 | | | | | 10.1128/AEM.72.1.437-442.2006 | | Larvae | 1st instar | Purified protein | Diet incorporation | No mortality but significant stunting at 100µg/ml | Colin Berry | 2025-09-04 |
| 1075 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIVALFSNYDSRRYPIRTVSQLTREIYTNPVLENFDGSFRGMAQRIEQNIRQPHLMDILNSITIYTDVHRGFNYWSGHQ
ITASPVGFSGPEFAFPLFGNAGNAAPPVLVSLTGLGIFRTLSSPLYRRIILGSGPNNQELFVLDGTEFSFASLTTNLPST
IYRQRGTVDSLDVIPPQDNSVPPRAGFSHRLSHVTMLSQAAGAVYTLRAPTFSWQHRSAEFNNIIPSSQITQIPLTKSTN
LGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSNL
QSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVT
DYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVT
LLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRC
APHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKR
AEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEEL
EGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYG
EGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRE
NPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138259 | Cry1Aa3 | No | Not applicable | Lepidoptera | Sesamia nonagrioides | Yes | 236805 | | | | 0.31 | 10.1128/AEM.72.4.2594-2600.2006 | | Larvae | 1st instar | Purified protein | Surface contamination | 31% mortality at 1000ng/cm2 | Colin Berry | 2025-09-04 |
| 1076 | | 130376 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 468 to >5000 | ng/cm2 | | | 10 .1128/AEM.01393-18 | | Larvae | 1st Instar | Spore crystal mix | Surface contamination | Many point mutations also reported. Range of sensitivities reported to different isolates of S frugiperda: wild type LC50s, 1420ng/cm2 Sf-Valle del Fuerte; 482ng/cm2 Sf-La Laguna; 1590ng/cm2 SfS-Mex; 468ng/cm2 SfLab-Brazil; >5000ng/cm2 Sf-IBTsensitivities reported to different isolates of S frugiperda: LC50s , population Sf-Valle del Fuerte | Leopoldo Palma | 2024-06-14 |
| 1077 | | 46240 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 30-47 | ng/cm2 | | | 10.1002/ps.6170 | | Larvae | 1st Instar | Purified protein | Surface contamination | Sample size unclear per conc. LC50 of 30 and 47 ng/cm2 in repeat assays | Chloe Tucker | 2022-12-16 |
| 1078 | | 137908 | Cry1Ab | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | 0.36 | µg/g | | | 10.1016/j.cropro.2025.107216 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1079 | | 47591 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 5.8 | ng/ml | | | Biopesticides International 3 (1):58-70 | | unknown | | | leaf dip | Field populations tested and LC50 varied widely by origin of insect from 5.8ng/ml to 485.5ng/ml | Jakub Baranek | 2024-08-28 |
| 1080 | | 47087 | Cry1Ab | No | Not applicable | Lepidoptera | Plodia interpunctella | Yes | 58824 | 1320.84 | µg/g | | | 10.1111/jen.12241 | | Larvae | 3rd instar | Cell lysate | diet incorporation | | Jakub Baranek | 2024-11-04 |
| 1081 | | 138945 | Cry1Ab | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | | | | 1 | 10.1126/science.1146454 | | Larvae | | | | | Colin Berry | 2025-09-04 |
| 1082 | | 138435 | Cry1Ab | No | Not applicable | Lepidoptera | Agrotis segetum | Yes | 47767 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1603/EN09150 | | Larvae | | Transgenic plant | Transgenic plant | No significant effect under field conditions (although notes reports of activity in the laboratory) | Colin Berry | 2025-09-04 |
| 1083 | | 138536 | Cry1Ab | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | No | 7539 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3390/toxins12020133 | | Larvae | 1st instar | Spore crystal mix | Leaf dip | Not toxic at 100µg/ml | Colin Berry | 2025-09-04 |
| 1084 | | 137781 | Cry1Ab | No | Not applicable | Lepidoptera | Agrotis ipsilon | No | 56364 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1007/s00203-003-0543-6 | | Larvae | 1st instar | Purified protein | Surface contamination | LC50 > 16000ng/cm2 | Colin Berry | 2025-09-04 |
| 1085 | | 47437 | Cry1Ab | No | Not applicable | Coleoptera | Cylas puncticollis | No | 1550038 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1603/EC09432 | | Larvae | 1st Instar | Other (add to comments) | Diet incorporation | partially purified protoxins assayed | Colin Berry | 2024-03-27 |
| 1086 | | 47436 | Cry1Ab | No | Not applicable | Coleoptera | Cylas brunneus | No | 1827352 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1603/EC09432 | | Larvae | 2nd Instar | Other (add to comments) | Diet incorporation | partially purified protoxins assayed | Colin Berry | 2024-03-26 |
| 1087 | | 138491 | Cry1Ab | No | Not applicable | Lepidoptera | Agrotis ipsilon | No | 56364 | 3.44 | µg/g | | | 10.3390/insects16020119 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1088 | | 129447 | Cry1Ab | No | Not applicable | Coleoptera | Cryptolaemus montrouzieri | No | 559131 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1017/S0007485309990290 | | Adults | | | Diet incorporation | | Colin Berry | 2024-06-13 |
| 1089 | | 129445 | Cry1Ab | No | Not applicable | Coleoptera | Adalia bipunctata | No | 7084 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1017/S0007485309990290 | | Larvae | 1st and 2nd instar | | Diet incorporation | Mortality higher but not significantly higher than control | Colin Berry | 2024-06-13 |
| 1090 | | 47332 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | 6 | ng/cm2 | | | 10.1371/journal.pone.0068164 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Neil Crickmore | 2024-12-12 |
| 1091 | | 46506 | Cry1Ab | No | Not applicable | Lepidoptera | Sesamia inferens | Yes | 492764 | 3730 | ng/g | | | 10.1016/j.jip.2010.05.002 | | unknown | | Purified protein | diet incorporation | | Jakub Baranek | 2023-08-09 |
| 1092 | | 129444 | Cry1Ab | No | Not applicable | Araneae | Pardosa pseudoannulata | No | 330961 | | | | | 10.1016/j.ecoenv.2023.115799 | | | | Transgenic plant | Transgenic plant | No significant mortality but significant effects on development time | Colin Berry | 2024-07-25 |
| 1093 | | 46206 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 26 | µg/cm2 | | | 10.1002/ps.1798 | | | | Purified protein | surface contamination | | Jakub Baranek | 2022-12-11 |
| 1094 | | 46746 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera exigua | No | 7107 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/S2095-3119(12)60050-1 | | Larvae | 1st Instar | | surface contamination | LC50>40000ng/cm2 | Jakub Baranek | 2024-05-05 |
| 1095 | | 138436 | Cry1Ab | No | Not applicable | Araneae | Ummeliata insecticeps | No | 447592 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1603/EN10003 | | Spiderlings | 2nd instar | Transgenic fed Nilaparvata lugens | Transgenic fed Nilaparvata lugens | | Colin Berry | 2025-09-04 |
| 1096 | | 46356 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 3760 | ng/cm2 | | | 10.1007/s12010-019-02952-z | | Larvae | 1st Instar | Purified protein | Surface contamination | | Jakub Baranek | 2023-11-04 |
| 1097 | | 46994 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | No | 7108 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1093/jisesa/iex003 | | Larvae | 1st instar | Purified protein | diet incorporation | | Jakub Baranek | 2024-08-01 |
| 1098 | | 133563 | Cry1Ab | No | Not applicable | Coleoptera | Atheta coriaria | No | 877792 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1017/S0007485309990290 | | Adults | | | Diet incorporation | | Colin Berry | 2024-06-13 |
| 1099 | | 138141 | Cry1Ab | No | Not applicable | Lepidoptera | Sesamia inferens | Yes | 492764 | 71.99 | | | | 10.1128/AEM.01544-14 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1100 | | 137993 | Cry1Ab | No | Not applicable | Lepidoptera | Earias vittella | Yes | 1372994 | 0.447 | ng/cm2 | | | 10.1016/S0261-2194(99)00058-7 | | Larvae | 1st instar | Purified protein | Leaf dip | Mean LC50 presented with some variation depending on region of origin of larvae | Colin Berry | 2025-09-04 |
| 1101 | | 139241 | Cry1Ab | No | Not applicable | Lepidoptera | Lymantria dispar | Yes | 13123 | | | | | 10.1128/AEM.67.9.3923-3927.2001 | | Larvae | 4th or 5th instar | Purified protein | Injection or force feeding | Injection produced feeding inhibition; Forced feeding, frass feeding dose 22.0 ng/larva; cell mortality 35.3% (control 26.4%) | Colin Berry | 2025-10-14 |
| 1102 | | 137995 | Cry1Ab | No | Not applicable | Hemiptera | Cyrtorhinus lividipennis | No | 1032904 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/S2095-3119(14)60978-3 | | | | Transgenic plant with prey feeding | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1103 | | 137996 | Cry1Ab | No | Not applicable | Hemiptera | Orius tantillus | No | 82749 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/S2095-3119(16)61414-4 | | | | Transgenic plant with prey feeding | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1104 | | 137997 | Cry1Ab | No | Not applicable | Thysanoptera | Stenchaetothrips biformis | No | 1100830 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/S2095-3119(16)61414-4 | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1105 | | 138017 | Cry1Ab | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | | | | 1 | 10.1023/A:1009658024114 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1106 | | 138018 | Cry1Ab | No | Not applicable | Lepidoptera | Scirpophaga incertulas | Yes | 72366 | | | | 1 | 10.1023/A:1009658024114 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1107 | | 138019 | Cry1Ab | No | Not applicable | Lepidoptera | Cnaphalocrocis medinalis | Yes | 437488 | | | | 1 | 10.1023/A:1009658024114 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1108 | | 138020 | Cry1Ab | No | Not applicable | Lepidoptera | Herpetogramma licarsisalis | Yes | 1209551 | | | | 1 | 10.1023/A:1009658024114 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1109 | | 138021 | Cry1Ab | No | Not applicable | Lepidoptera | Sesamia inferens | Yes | 492764 | | | | 1 | 10.1023/A:1009658024114 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1110 | | 138022 | Cry1Ab | No | Not applicable | Lepidoptera | Naranga aenescens | Yes | 2736687 | | | | 1 | 10.1023/A:1009658024114 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1111 | | 138023 | Cry1Ab | No | Not applicable | Lepidoptera | Mycalesis gotama | Yes | 76254 | | | | 1 | 10.1023/A:1009658024114 | | Larvae | 3rd instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1112 | | 138024 | Cry1Ab | No | Not applicable | Lepidoptera | Parnara guttata | Yes | 218706 | | | | 1 | 10.1023/A:1009658024114 | | Larvae | 3rd instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1113 | | 137952 | Cry1Ab | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | 0.4 | ng/cm2 | | | 10.1016/j.jip.2015.01.013 | | Larvae | 1st instar | Purified protein | | | Colin Berry | 2025-09-04 |
| 1114 | | 48978 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.7 | | | | 10.1186/s12915-022-01226-1 | | Larvae | 3rd Instar | Purified protein | Leaf-dip | | Leopoldo Palma | 2023-04-21 |
| 1115 | | 137896 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | 11.5 | ng/cm2 | | | 10.1016/j.cropro.2011.05.009 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1116 | | 138041 | Cry1Ab | No | Not applicable | Lepidoptera | Tuta absoluta | Yes | 702717 | 11.9 | µg/ml | | | 10.1046/j.1365-2672.2003.01840.x | | Larvae | | | | | Colin Berry | 2025-09-04 |
| 1117 | | 138404 | Cry1Ab | No | Not applicable | Araneae | Pardosa pseudoannulata | No | 330961 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1371/journal.pone.0035164 | | Spiderlings | 2nd instar | Transgenic fed Nilaparvata lugens | Transgenic fed Nilaparvata lugens | | Colin Berry | 2025-09-04 |
| 1118 | | 138045 | Cry1Ab | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | | | | 1 | 10.1073/pnas.95.6.2767 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1119 | | 138046 | Cry1Ab | No | Not applicable | Lepidoptera | Scirpophaga incertulas | Yes | 72366 | | | | 97.4 to 100% | 10.1073/pnas.95.6.2767 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1120 | | 137897 | Cry1Ab | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | 10.4 | ng/cm2 | | | 10.1016/j.cropro.2011.05.009 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1121 | | 130362 | Cry1Ab | No | Not applicable | Sarcoptiformes | Oppia nitens | No | 1686743 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1093/jee/90.1.113 | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-08-07 |
| 1122 | | 137898 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | 4 | ng/cm2 | | | 10.1016/j.cropro.2011.05.009 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1123 | | 137866 | Cry1Ab | No | Not applicable | Coleoptera | Oulema melanopus | No | 294584 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1007/s11829-011-9178-8 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1124 | | 138283 | Cry1Ab | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | 0.68 | ng/mm2 | | | 10.1128/jb.173.13.3966-3976.1991 | | Larvae | 1st instar | Spore and/or crystal suspension | Surface contamination | | Colin Berry | 2025-09-04 |
| 1125 | | 130375 | Cry1Ab | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 3.4 | ng/cm2 | | | 10 .1128/AEM.01393-18 | | Larvae | 1st Instar | Spore crystal mix | Surface contamination | Many point mutations also reported. | Leopoldo Palma | 2024-06-14 |
| 1126 | | 46550 | Cry1Ab | No | Not applicable | Hemiptera | Nilaparvata lugens | Yes | 108931 | 190.23 (136.67-243.80) | µg/ml | | | 10.1016/j.jip.2013.09.001 | | | | Purified protein | Membrane feeding | | Ruchir Mishra | 2023-10-22 |
| 1127 | | 138061 | Cry1Ab | No | Not applicable | Lepidoptera | Maruca vitrata | Yes | 497515 | | | | | 10.1093/jee/toz367 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | Activity measured by significantly reduced plant damage | Colin Berry | 2025-09-04 |
| 1128 | | 130366 | Cry1Ab | No | Not applicable | Thysanoptera | Frankliniella tenuicornis | No | 153972 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1111/j.1570-7458.2005.00298.x | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-07-29 |
| 1129 | | 130367 | Cry1Ab | No | Not applicable | Trichoptera | Chaetopteryx spp. | No | 492549 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-020-62055-2 | | Larvae | | Purified protein | Surface contamination | Some changes in lipid and case width reported | Colin Berry | 2024-07-23 |
| 1130 | | 130368 | Cry1Ab | No | Not applicable | Trichoptera | Lepidostoma spp. | No | 158438 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1603/EN09037 | | Larvae | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-07-25 |
| 1131 | | 130369 | Cry1Ab | No | Not applicable | Trichoptera | Pycnopsyche scabripennis | No | 910961 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1603/EN09037 | | Larvae | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-07-25 |
| 1132 | | 138087 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | 0.23 | µg/g | | | 10.1111/j.1574-6968.2007.01053.x | | Larvae | 1st instar | Spore and/or crystal suspension | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1133 | | 138202 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 25.3 to 63.2 | µg/g | | | 10.1128/aem.61.6.2086-2092.1995 | | Larvae | 1st instar | | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1134 | | 130370 | Cry1Ab | No | Not applicable | Trichoptera | Sericostoma spp. | No | 177789 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-020-62055-2 | | Larvae | | Purified protein | Surface contamination | | Colin Berry | 2024-07-23 |
| 1135 | | 138090 | Cry1Ab | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 1.96 | µg/g | | | 10.1111/j.1574-6968.2007.01053.x | | Larvae | 1st instar | Spore and/or crystal suspension | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1136 | | 137885 | Cry1Ab | No | Not applicable | Lepidoptera | Sesamia calamistis | Yes | 134397 | | | | | 10.1016/j.cropro.2008.08.016 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | Significantly reduced larval survival | Colin Berry | 2025-09-04 |
| 1137 | | 138281 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | 0.27 | ng/mm2 | | | 10.1128/jb.173.13.3966-3976.1991 | | Larvae | 1st instar | Spore and/or crystal suspension | Surface contamination | | Colin Berry | 2025-09-04 |
| 1138 | | 47017 | Cry1Ab | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | No | 7539 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1111/j.1439-0418.2010.01601.x | | Larvae | 1st instar | | diet incorporation | Mortality observed after 4 days of only 1% at 142ng/ml | Jakub Baranek | 2024-01-31 |
| 1139 | | 138140 | Cry1Ab | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 1.84 | | | | 10.1128/AEM.01544-14 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1140 | | 47496 | Cry1Ab | No | Not applicable | Hemiptera | Diaphorina citri | Yes | 121845 | 120 | µg/ml | | | 10.3390/toxins11030173 | | Adult | | Purified protein | Membrane feeding | | Ruchir Mishra | 2024-05-25 |
| 1141 | | 47126 | Cry1Ab | No | Not applicable | Hemiptera | Acyrthosiphon pisum | Yes | 7029 | | | | 25% at 500 µg/ml | 10.1128/AEM.00686-09 | | Nymph | Not specified | Purified protein | Membrane feeding | mortality was observed after 3 to 6 days of exposure | Ruchir and Suresh | 2024-05-20 |
| 1142 | | 137665 | Cry1Ab | No | Not applicable | Lepidoptera | Striacosta albicosta | No | 437490 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1603/EC13190 | | Larvae | 1st instar | Purified protein | Surface contamination | Insensitive up to 25,000 ng/cm2 | Colin Berry | 2025-09-04 |
| 1143 | | 138155 | Cry1Ab | No | Not applicable | Lepidoptera | Lobesia botrana | Yes | 209534 | 1.4 | µg/ml | | | 10.1128/AEM.02861-05 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1144 | | 132760 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 867 | ng/cm2 | | | | MX2010011925A | larvae | 1st instar | | | Assay methodology was not described. | Victoria Valby | 2023-12-18 |
| 1145 | | 138159 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.08 | µg/ml | | | 10.1128/AEM.02861-05 | | Larvae | 3rd instar | Purified protein | Leaf dip | | Colin Berry | 2025-09-04 |
| 1146 | | 138273 | Cry1Ab | No | Not applicable | Lepidoptera | Mamestra brassicae | Yes | 55057 | 12.5 | 10(7) cells/cm2 | | | 10.1128/jb.172.12.6783-6788.1990 | | Larvae | 2nd instar | Bacterial culture | Surface contamination | Protein called BtII / CryIA(b) in publication | Colin Berry | 2025-09-04 |
| 1147 | | 129757 | Cry1Ab | No | Not applicable | Lepidoptera | Thaumetopoea pityocampa | Yes | 208016 | 895 | pg/µl | | | 10.1128/AEM.66.4.1553-1558.2000 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-23 |
| 1148 | | 129756 | Cry1Ab | No | Not applicable | Lepidoptera | Thaumetopoea pityocampa | Yes | 208016 | 895 | | | | 10.1006/pest.1999.2426 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-06-13 |
| 1149 | | 129755 | Cry1Ab | No | Not applicable | Lepidoptera | Thaumatotibia leucotreta | Yes | 463830 | 22.92 | ng | | | 10.1016/j.cropro.2011.09.019 | | Larvae | 1st instar | Other | Other (add to comments) | Droplet feeding assay using semi purified inclusion bodies from E. coli expression. LD50 values reported | Colin Berry | 2024-07-29 |
| 1150 | | 129754 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera litura | Yes | 69820 | 6.65 | µg/ml | | | 10.11416/kontyushigen1930.68.195 | | Larvae | 3rd Instar | Purified crystals | Diet incorporation | | Colin Berry | 2024-06-13 |
| 1151 | | 129753 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.008-0.02 | µg per 15mg diet | | | 10.1016/j.jspr.2010.01.003 | | larvae | 1st instar | Purified protein | Surface contamination | Higher LC50 for resistant colonies also reported | Colin Berry | 2024-06-13 |
| 1152 | | 129752 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.002 | µg/ml | | | 10.1002/ps.313 | | Larvae | 3rd Instar | Purified crystals | Leaf-dip | Use of resistant insects, different generations and cross-resistance is also described in the work | Colin Berry | 2024-06-13 |
| 1153 | | 129751 | Cry1Ab | No | Not applicable | Lepidoptera | Platynota stultana | Yes | 708047 | 0.8 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1154 | | 129750 | Cry1Ab | No | Not applicable | Lepidoptera | Pandemis pyrusana | Yes | 1144657 | 12.6 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1155 | | 129741 | Cry1Ab | No | Not applicable | Lepidoptera | Danaus plexippus | Yes | 13037 | 3.3 | ng/ml | | | 10.1073/pnas.211297698 | | Larvae | 1st instar | Purified protein | Diet incorporation | Higher LC50 reported with older instars | Colin Berry | 2024-06-13 |
| 1156 | | 129749 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | 10.1603/EN09037 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | Reduced weight gain and delayed development using senesced leaf tissue | Colin Berry | 2024-07-25 |
| 1157 | | 129748 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | 10.1017/S0007485309990290 | | Larvae | | | Diet incorporation | Reported toxic, data not shown | Colin Berry | 2024-06-13 |
| 1158 | | 129747 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | 10.1016/j.jinsphys.2003.11.004 | | Larvae | 1st instar | Purified protein | Diet incorporation | EC50 5ng/ml | Colin Berry | 2024-07-25 |
| 1159 | | 129746 | Cry1Ab | No | Not applicable | Lepidoptera | Orgyia leucostigma | Yes | 95259 | 25 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1160 | | 129745 | Cry1Ab | No | Not applicable | Lepidoptera | Malacosoma disstria | Yes | 40071 | 25.5 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1161 | | 129744 | Cry1Ab | No | Not applicable | Lepidoptera | Lymantria monacha | Yes | 78897 | | | | | 10.1128/AEM.66.4.1553-1558.2000 | | Larvae | 2nd instar | Purified protein | Surface contamination | Inhibition of molting from 2nd to 3rd instar at 200ng/cm2: no significant mortality | Colin Berry | 2024-07-23 |
| 1162 | | 129743 | Cry1Ab | No | Not applicable | Lepidoptera | Lymantria dispar | Yes | 13123 | 22 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1163 | | 129742 | Cry1Ab | No | Not applicable | Lepidoptera | Lobesia botrana | Yes | 209534 | 1.4 | µg/ml | | | 10.1128/AEM.01511-06 | | Larvae | 1st Instar | Purified protein | Diet incorporation | | Colin Berry | 2024-06-13 |
| 1164 | | 129740 | Cry1Ab | No | Not applicable | Lepidoptera | Cydia pomonella | Yes | 82600 | 0.292 | µg/ml | | | 10.1007/s002849910040 | | Larvae | 1st instar | Purified crystals | Surface contamination | | Colin Berry | 2024-06-13 |
| 1165 | | 129739 | Cry1Ab | No | Not applicable | Lepidoptera | Conopomorpha cramerella | Yes | 538958 | 19.9 | ng/cm2 | | | 10.1002/ps.927 | | | 3rd-4th instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-24 |
| 1166 | | 46649 | Cry1Ab | No | Not applicable | Lepidoptera | Conogethes punctiferalis | Yes | 1133088 | 1.08 | ng/cm2 | | | 10.1016/j.jip.2020.107507 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2024-01-29 |
| 1167 | | 129738 | Cry1Ab | No | Not applicable | Lepidoptera | Choristoneura rosaceana | Yes | 27543 | 1.7 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1168 | | 129737 | Cry1Ab | No | Not applicable | Lepidoptera | Choristoneura pinus | Yes | 27542 | 17.3 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1169 | | 129736 | Cry1Ab | No | Not applicable | Lepidoptera | Choristoneura occidentalis | Yes | 27541 | 10.8 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1170 | | 138640 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | 10.4161/gmcr.1.5.14765 | | Larvae | | Transgenic plant | Transgenic plant | Significant reductions in populations | Colin Berry | 2025-09-04 |
| 1171 | | 138639 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | 10.4161/gmcr.1.5.14765 | | Larvae | | Transgenic plant | Transgenic plant | Almost 100% control | Colin Berry | 2025-09-04 |
| 1172 | | 138638 | Cry1Ab | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | 10.4161/gmcr.1.5.14765 | | Larvae | | Transgenic plant | Transgenic plant | Significant reductions in populations | Colin Berry | 2025-09-04 |
| 1173 | | 129735 | Cry1Ab | No | Not applicable | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | 3.13 | ng total protein | | | 10.1128/aem.57.6.1650-1655.1991 | | Cultured cells | | Purified protein | Addition to cell culture | | Colin Berry | 2024-07-19 |
| 1174 | | 129734 | Cry1Ab | No | Not applicable | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | 13.2 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | | Colin Berry | 2024-07-19 |
| 1175 | | 129732 | Cry1Ab | No | Not applicable | Lepidoptera | Busseola fusca | Yes | 236788 | | | 94% mortality | | 10.1371/journal.pone.0226476 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | 94% mortality with a dose of 14.9µg/g after 14 days | Colin Berry | 2024-07-19 |
| 1176 | | 138632 | Cry1Ab | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | 258.84 | ng/larva | | | 10.3390/toxins7124894 | | Larvae | 4th instar | Purified protein | Force feeding | | Colin Berry | 2025-09-04 |
| 1177 | | 138631 | Cry1Ab | No | Not applicable | Lepidoptera | Agrotis ipsilon | No | 56364 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3390/toxins7124894 | | Larvae | 4th instar | Purified protein | Force feeding | No toxicity at 2000ng/larva | Colin Berry | 2025-09-04 |
| 1178 | | 129731 | Cry1Ab | No | Not applicable | Lepidoptera | Bombyx mori | No | 7091 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.11416/kontyushigen1930.68.195 | | Larvae | 4th Instar | Purified crystals | Other (add to comments) | fed by oral injection | Colin Berry | 2024-06-13 |
| 1179 | | 129730 | Cry1Ab | No | Not applicable | Lepidoptera | Bombyx mori | Yes | 7091 | 34 | ng/cm2 | | | 10.1042/BJ20070956 | | Larvae | 1st Instar | Other (add to comments) | Leaf-dip | Bombyx mori strain J65 (which is more susceptible than others to Cry1Ab). Inclusions assayed | Colin Berry | 2024-06-13 |
| 1180 | | 129729 | Cry1Ab | No | Not applicable | Lepidoptera | Argyrotaenia citrana | Yes | 96881 | 3.5 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1181 | | 129728 | Cry1Ab | No | Not applicable | Lepidoptera | Actebia fennica | No | 989868 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1182 | | 129695 | Cry1Ab | No | Not applicable | Isopoda | Porcellio scaber | No | 64697 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1078/1439-1791-00124 | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-08-07 |
| 1183 | | 130353 | Cry1Ab | No | Not applicable | Poduromorpha | Xenylla grisea | No | 187712 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/S0031-4056(24)00312-3 | | | | Purified protein | Diet incorporation | | Colin Berry | 2024-07-25 |
| 1184 | | 129694 | Cry1Ab | No | Not applicable | Isopoda | Porcellio scaber | No | 64697 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1078/1439-1791-00024 | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-08-07 |
| 1185 | | 129693 | Cry1Ab | No | Not applicable | Isopoda | Caecidotea communis | No | 2202326 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1603/EN09037 | | Larvae | | Transgenic plant | Transgenic plant | Sublethal effects observed | Colin Berry | 2024-07-25 |
| 1186 | | 46582 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 813.78 | ng/cm2 | | | 10.1016/j.jip.2014.08.009 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Chloe Tucker | 2023-11-23 |
| 1187 | | 137881 | Cry1Ab | No | Not applicable | Neuroptera | Chrysoperla carnea | No | 189513 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.biocontrol.2007.12.002 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1188 | | 130350 | Cry1Ab | No | Not applicable | Neuroptera | Chrysoperla carnea | No | 189513 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.jinsphys.2003.11.004 | | Larvae | 1st instar | Purified protein | Other (add to comments) | Direct feeding in sucrose solution | Colin Berry | 2024-07-25 |
| 1189 | | 129625 | Cry1Ab | No | Not applicable | Hemiptera | Orius albidipennis | No | 1005351 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1093/ee/36.5.1246 | | Nymphs | | Other | Other (add to comments) | Nyphs fed on Helicoverpa armigera prefed with toxin (confirmed toxic) | Colin Berry | 2024-07-29 |
| 1190 | | 129624 | Cry1Ab | No | Not applicable | Hemiptera | Diaphorina citri | No | 121845 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1111/1744-7917.12654 | | Nymph | 3rd Instar | Spore crystal mix | | mortality not significantly different from control at 5 days | Colin Berry | 2023-12-18 |
| 1191 | | 129608 | Cry1Ab | No | Not applicable | Entomobryomorpha | Folsomia candida | No | 158441 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1093/jee/90.1.113 | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-08-07 |
| 1192 | | 129607 | Cry1Ab | No | Not applicable | Entomobryomorpha | Folsomia candida | No | 158441 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/S0031-4056(24)00312-3 | | | | Purified protein | Diet incorporation | | Colin Berry | 2024-07-25 |
| 1193 | | 46975 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 1341 | ng/cm2 | | | 10.1093/jee/tox311 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Chloe Tucker | 2024-12-20 |
| 1194 | | 47171 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 131->5000 | ng/cm2 | | | 10.1128/AEM.01580-20 | | Larvae | Not specified | Spore crystal mix | Surface contamination | Strain dependent toxicity: Sf-UAEM1 strain131ng/cm2; SfS-Mex 1590ng/cm2; Sf-La Laguna 482ng/cm2; Sf-Valle del Fuerte 1420ng/cm2; Sf-IBT non-susceptible >5000ng/cm2 | Chloe Tucker | 2024-04-07 |
| 1195 | | 138272 | Cry1Ab | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | <0.025 | 10(7) cells/cm2 | | | 10.1128/jb.172.12.6783-6788.1990 | | Larvae | 2nd instar | Bacterial culture | Surface contamination | Protein called BtII / CryIA(b) in publication | Colin Berry | 2025-09-04 |
| 1196 | | 47333 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 783 | ng/cm2 | | | 10.1371/journal.pone.0068164 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Chloe Tucker | 2024-12-13 |
| 1197 | | 49690 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 15 | ng/cm2 | | | 10.1006/bbrc.1996.1099 | | Larvae | 3rd Instar | Not specified | Surface contamination | obtained as a recombinant protein | Jorge Zimmermann | 2023-04-21 |
| 1198 | | 49717 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.086 | µg/ml | | | 10.1007/s002849900438 | | Larvae | 2nd Instar | Purified protein | Leaf-dip | LC50s at 5 days for protoxin 0.086µg/ml and activated active toxin 0.130µg/ml (2 day LC50 also reported) | Jorge Zimmermann | 2023-04-21 |
| 1199 | | 49668 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 6.7 | ng/cm2 | | | 10.1073/pnas.88.12.5119 | | Larvae | 3rd Instar | Purified crystals | Surface contamination | CryIA(b) from B. thuringiensis var. berliner 1715; the production of resistant insects is also described in the work | Jorge Zimmermann | 2023-04-21 |
| 1200 | | 49710 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 99 % mortality at 10 mg/l | 10.1073/pnas.94.24.12780 | | Larvae | 3rd Instar | | Leaf-dip | Use of resistant insects is also described in the work; F1 larvae from single-pair hybrid crosses are use | Jorge Zimmermann | 2023-04-21 |
| 1201 | | 49704 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 100 % mortality at 100 mg/l | 10.1073/pnas.94.5.1640 | | Larvae | 3rd Instar | Not specified | Leaf-dip | Use of resistant insects is also described in the work | Jorge Zimmermann | 2023-04-21 |
| 1202 | | 49676 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 90% mortality at 100 µg/ml | 10.1074/jbc.270.20.11887 | | Larvae | 3rd Instar | Not specified | Leaf-dip | the production of resistant insects is also described in the work | Jorge Zimmermann | 2023-04-21 |
| 1203 | | 48925 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.0042 | µg/ml | | | 10.1128/AEM.66.4.1509-1516.2000 | | Larvae | 3rd Instar | Purified protein | Leaf-dip | Use of resistant insects, different generations and cross-resistance is also described in the work | Jorge Zimmermann | 2023-04-21 |
| 1204 | | 139186 | Cry1Ab | No | Not applicable | Lepidoptera | Achaea janata | Yes | 378752 | 32.03 | ng/cm2 | | | 10.1042/BJ20070054 | | Larvae | 2nd instar | Purified protein | Leaf-dip | | Colin Berry | 2025-10-14 |
| 1205 | | 48935 | Cry1Ab | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 1.6 | mg/l | | | 10.1128/AEM.67.7.3216-3219.2001 | | Larvae | 3rd Instar | Purified protein | Leaf-dip | Use of resistant insects and different generations resistance is also described in the work | Jorge Zimmermann | 2023-04-21 |
| 1206 | | 138284 | Cry1Ab | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | 16.9 | ng/mm2 | | | 10.1128/jb.173.13.3966-3976.1991 | | Larvae | 1st instar | Spore and/or crystal suspension | Surface contamination | | Colin Berry | 2025-09-04 |
| 1207 | | 133582 | Cry1Ab | No | Not applicable | Crassiclitellata | Eisenia fetida | No | 6396 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.ecoenv.2024.117592 | | Adult | | Transgenic plant | Transgenic plant | | Colin Berry | 2025-01-13 |
| 1208 | | 137831 | Cry1Ab | No | Not applicable | Coleoptera | Adalia bipunctata | No | 7084 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1007/s11248-010-9430-5 | | Larvae | 1st instar | Transgenic plant with prey feeding | Transgenic plant | Purified proteins also showed no effect on target | Colin Berry | 2025-09-04 |
| 1209 | | 137820 | Cry1Ab | No | Not applicable | Lepidoptera | Cnaphalocrocis patnalis | Yes | 1591229 | 92.76 | ng/cm2 | | | 10.1007/s002840010134 | | Larvae | | | Leaf dip | Three day old larvae used. Insect described using synonym Marasmia patnalis | Colin Berry | 2025-09-04 |
| 1210 | | 138271 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 5.6 | 10(7) cells/cm2 | | | 10.1128/jb.172.12.6783-6788.1990 | | Larvae | 2nd instar | Bacterial culture | Surface contamination | Protein called BtII / CryIA(b) in publication | Colin Berry | 2025-09-04 |
| 1211 | | 137816 | Cry1Ab | No | Not applicable | Lepidoptera | Cnaphalocrocis medinalis | Yes | 437488 | 98.21 | ng/cm2 | | | 10.1007/s002840010134 | | Larvae | | | Leaf dip | Three day old larvae used | Colin Berry | 2025-09-04 |
| 1212 | | 47414 | Cry1Ab | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | 40 | ng/cm2 | | | 10.1590/S0100-204X2014000200001 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-04-03 |
| 1213 | | 47047 | Cry1Ab | No | Not applicable | Lepidoptera | Chilo partellus | Yes | 236792 | 4.72 | ng/cm2 | | | 10.1111/j.1472-765X.2010.02856.x | | Larvae | 4th instar | Purified protein | surface contamination | | Jakub Baranek | 2024-02-03 |
| 1214 | | 46505 | Cry1Ab | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 660 | ng/g | | | 10.1016/j.jip.2010.05.002 | | unknown | | Purified protein | diet incorporation | | Jakub Baranek | 2023-07-09 |
| 1215 | | 47067 | Cry1Ab | No | Not applicable | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | 8.6 | ng/larva | | | 10.1111/j.1574-6968.2002.tb11378.x | | Larvae | 6th instar | Purified crystals | droplet feeding | Results expressed as EC50 in ng toxin per larva | Jakub Baranek | 2024-03-22 |
| 1216 | | 47415 | Cry1Ab | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | 35 | ng/cm2 | | | 10.1590/S0100-204X2014000200001 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-05-03 |
| 1217 | | 47086 | Cry1Ab | No | Not applicable | Lepidoptera | Ephestia kuehniella | Yes | 40079 | 685.67 | µg/g | | | 10.1111/jen.12241 | | Larvae | 3rd instar | Cell lysate | diet incorporation | | Jakub Baranek | 2024-10-04 |
| 1218 | | 138282 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 38.8 | ng/mm2 | | | 10.1128/jb.173.13.3966-3976.1991 | | Larvae | 1st instar | Spore and/or crystal suspension | Surface contamination | | Colin Berry | 2025-09-04 |
| 1219 | | 46471 | Cry1Ab | No | Not applicable | Lepidoptera | Epinotia aporema | Yes | 437486 | 550 | ng/ml | | | 10.1016/j.jip.2006.09.002 | | Larvae | 1st Instar | Purified crystals | diet incorporation | | Jakub Baranek | 2023-04-08 |
| 1220 | | 129555 | Cry1Ab | No | Not applicable | Diptera | Tipula abdominalis | No | 560804 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1603/EN09037 | | Larvae | | Transgenic plant | Transgenic plant | Sublethal effects observed | Colin Berry | 2024-07-25 |
| 1221 | | 47360 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 403 | ng/cm2 | | | 10.1371/journal.pone.0119544 | | Larvae | 2nd Instar | Spore crystal mix | Surface contamination | | Chloe Tucker | 2024-09-01 |
| 1222 | | 129526 | Cry1Ab | No | Not applicable | Crassiclitellata | Eisenia andrei | No | 168636 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3390/s121217155 | | Adult | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-08-07 |
| 1223 | | 47508 | Cry1Ab | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 1.797 | µg/cm2 | | | 10.3390/toxins12060375 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Chloe Tucker | 2024-06-06 |
| 1224 | | 138540 | Cry1Ab | No | Not applicable | Lepidoptera | Lobesia botrana | Yes | 209534 | 153 | ng/cm3 | | | 10.3390/toxins12020133 | | Larvae | 1st instar | Spore crystal mix | Surface contamination | | Colin Berry | 2025-09-04 |
| 1225 | | 46569 | Cry1Ab | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 0.64 | ng/larva | | | 10.1016/j.jip.2014.06.005 | | Larvae | 1st Instar | Purified crystals | droplet feeding | | Jakub Baranek | 2023-10-11 |
| 1226 | | 138538 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | 69 | ng/cm2 | | | 10.3390/toxins12020133 | | Larvae | 1st instar | Spore crystal mix | Surface contamination | | Colin Berry | 2025-09-04 |
| 1227 | | 47230 | Cry1Ab | No | Not applicable | Lepidoptera | Lymantria dispar | Yes | 13123 | 214 | ng/larva | | | 10.1128/AEM.62.2.583-586.1996 | | Larvae | 4th instar | Purified crystals | force feeding | | Jakub Baranek | 2024-01-09 |
| 1228 | | 138908 | Cry1Ab | No | Not applicable | Lepidoptera | Cydia pomonella | Yes | 82600 | 25 | ng/g | | | 10.1016/j.jip.2006.01.004 | | Larvae | 1st instar | Purified protein | Diet incorporation | Trypsin activated toxin LC50 given: solubilised protoxins have higher LC50 | Colin Berry | 2025-09-04 |
| 1229 | | 47485 | Cry1Ab | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | 6400 | ng/g | | | 10.3390/toxins10110454 | | Larvae | 1st instar | | diet incorporation | | Jakub Baranek | 2024-05-14 |
| 1230 | | 46993 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | 66.7% at 200ng/ml | 10.1093/jisesa/iex003 | | Larvae | 1st instar | Purified protein | diet incorporation | Mortality observed after 5 days | Jakub Baranek | 2024-07-01 |
| 1231 | | 138486 | Cry1Ab | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | | | | 0.187 | 10.3390/insects11040208 | | Larvae | 1st instar | Purified protein | Diet incorporation | 18.7% mortality at 200µg/g dose | Colin Berry | 2025-09-04 |
| 1232 | | 47018 | Cry1Ab | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | 68% at 70 ng/ml | 10.1111/j.1439-0418.2010.01601.x | | Larvae | 1st instar | | diet incorporation | Mortality observed after 7 days | Jakub Baranek | 2024-01-02 |
| 1233 | | 138937 | Cry1Ab | No | Not applicable | Lepidoptera | Trichoplusia ni | Yes | 7111 | 0.3 | mg/cm2 | | | 10.1128/AEM.00664-09 | | Larvae | 3rd instar | | Surface contamination | | Colin Berry | 2025-09-04 |
| 1234 | | 47342 | Cry1Ab | No | Not applicable | Lepidoptera | Pectinophora gossypiella | Yes | 13191 | 103 | ng/ml | | | 10.1371/journal.pone.0080496 | | Larvae | 1st instar | Spore crystal mix | diet incorporation | | Jakub Baranek | 2024-12-22 |
| 1235 | | 138941 | Cry1Ab | No | Not applicable | Lepidoptera | Pectinophora gossypiella | Yes | 13191 | 0.11 | µg/ml | | | 10.1126/science.1146453 | | Larvae | | | | | Colin Berry | 2025-09-04 |
| 1236 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138462 | Cry1Ab1 | No | Not applicable | Hemiptera | Myzus persicae | No | 13164 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3390/ijms26072924 | | Nymphs | 4th instar | Purified protein | Leaf dip | | Colin Berry | 2025-09-04 |
| 1237 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129685 | Cry1Ab1 | No | Not applicable | Hymenoptera | Apis mellifera | No | 7460 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3389/fbioe.2024.1322985 | | | | | | No effect on survival or adult emergence at 4µg. Truncated proteins expressed. | Colin Berry | 2024-06-13 |
| 1238 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129758 | Cry1Ab1 | No | Not applicable | Lepidoptera | Thyrinteina arnobia | Yes | 714834 | | | | 100% mortality | 10.3389/fbioe.2024.1322985 | | larvae | 2nd instar | Transgenic plant | Other (add to comments) | Fed on transgenic plants: 100% mortality in 7 days. Truncated proteins expressed. | Colin Berry | 2024-06-13 |
| 1239 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129527 | Cry1Ab1 | No | Not applicable | Crassiclitellata | Eisenia fetida | No | 6396 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3389/fbioe.2024.1322985 | | | | | | No effect in 28 days at 2600µg/g. Truncated proteins expressed. | Colin Berry | 2024-06-13 |
| 1240 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129535 | Cry1Ab1 | No | Not applicable | Diplostraca | Daphnia magna | No | 35525 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3389/fbioe.2024.1322985 | | | | | | No effect in 48h at 30µg/ml. Truncated proteins expressed. | Colin Berry | 2024-06-13 |
| 1241 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129609 | Cry1Ab1 | No | Not applicable | Entomobryomorpha | Folsomia candida | No | 158441 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3389/fbioe.2024.1322985 | | | | | | No effect in 28 days at 2600µg/g. Truncated proteins expressed. | Colin Berry | 2024-06-13 |
| 1242 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHERLGNLEFLEGRAPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAK
ESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNN
GLSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEE
EVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYV
TKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129760 | Cry1Ab10 | No | Not applicable | Lepidoptera | Keiferia lycopersicella | Yes | 1511203 | | | | | 10.1038/nbt1289-1265 | | | | Transgenic plant | Transgenic plant | Assessed by insect absence/death and lack of plant damage after high infestation | Colin Berry | 2024-08-04 |
| 1243 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHERLGNLEFLEGRAPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAK
ESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNN
GLSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEE
EVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYV
TKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129759 | Cry1Ab10 | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | | | | | 10.1038/nbt1289-1265 | | | | Transgenic plant | Transgenic plant | Assessed by insect absence/death and lack of plant damage after high infestation | Colin Berry | 2024-08-04 |
| 1244 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHERLGNLEFLEGRAPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAK
ESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNN
GLSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEE
EVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYV
TKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129761 | Cry1Ab10 | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | | | | | 10.1038/nbt1289-1265 | | | | Transgenic plant | Transgenic plant | Assessed by reduced plant damage after high infestation | Colin Berry | 2024-08-04 |
| 1245 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138493 | Cry1Ab15 | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | | | | 59.9 to 100% | 10.3390/plants13243568 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1246 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137947 | Cry1Ab3 | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 150 to 971 | ng/cm2 | | | 10.1016/j.jip.2007.11.001 | | Larvae | | Purified protein | Surface contamination | 2 day old larvae used. Different levels of activity seen with different S exigua colonies | Colin Berry | 2025-09-04 |
| 1247 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138231 | Cry1Ab3 | No | Not applicable | Lepidoptera | Pectinophora gossypiella | Yes | 13191 | | | | 1 | 10.1128/AEM.66.10.4582-4584.2000 | | Larvae | 1st instar | | Diet incorporation | Data on activity against Cry1Ac resistant strains also detailed | Colin Berry | 2025-09-04 |
| 1248 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137892 | Cry1Ab3 | No | Not applicable | Lepidoptera | Earias insulana | No | 1231953 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.cropro.2011.04.010 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1249 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137932 | Cry1Ab3 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | | 10.1016/j.jip.2005.04.003 | | Larvae | 1st instar | Purified protein | Diet incorporation | Significant growth inhibition | Colin Berry | 2025-09-04 |
| 1250 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138260 | Cry1Ab3 | No | Not applicable | Lepidoptera | Sesamia nonagrioides | Yes | 236805 | 23 | ng/cm2 | | | 10.1128/AEM.72.4.2594-2600.2006 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1251 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138252 | Cry1Ab3 | No | Not applicable | Lepidoptera | Earias insulana | Yes | 1231953 | 0.45 | µg/ml | | | 10.1128/AEM.72.1.437-442.2006 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1252 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129733 | Cry1Ab3 | No | Not applicable | Lepidoptera | Cacyreus marshalli | Yes | 266946 | | | | | 10.1128/AEM.68.8.4090-4094.2002 | | | 3rd instar | Purified protein | Leaf dip | Growth inhibition close to 100% after 1mg/l leaf dip, 48h | Colin Berry | 2024-07-24 |
| 1253 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 46703 | Cry1Ab3 | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 692 | ng/cm2 | | | 10.1016/s0022-2011(02)00035-6 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-03-23 |
| 1254 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138659 | Cry1Ab3 | No | Not applicable | Lepidoptera | Prays oleae | Yes | 627135 | | | | approx 30% | Bulletin of Insectology (2012) 65 (1): 119-122 | | Larvae | 3rd instar | Spore crystal mix | Surface contamination | | Colin Berry | 2025-09-04 |
| 1255 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137763 | Cry1Ab3 | No | Not applicable | Lepidoptera | Trichoplusia ni | Yes | 7111 | 3.4 | ng/cm2 | | | 10.1006/jipa.2000.4946 | | Larvae | 1st instar | Purified protein | Surface contamination | Some difference in LC50 dependent on source | Colin Berry | 2025-09-04 |
| 1256 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 48964 | Cry1Ab3 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.002-0.6 | mg/l | | | 10.1128/AEM.67.10.4610-4613.2001 | | Larvae | 3rd Instar | Purified protein | Leaf-dip | Protein assayed against different P. xylostella isolates in different lab assays. Max and min LC50 reported here. | Jorge Zimmermann | 2023-04-21 |
| 1257 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 46704 | Cry1Ab3 | No | Not applicable | Lepidoptera | Helicoverpa punctigera | Yes | 27545 | 355 | ng/cm2 | | | 10.1016/s0022-2011(02)00035-6 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-03-24 |
| 1258 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCGEPNR
CAPQLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVK
RAEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEE
LEGRIFTAFSLYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGY
GEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYT
DGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129762 | Cry1Ab35 | No | Not applicable | Lepidoptera | Hyphantria cunea | Yes | 39466 | 4.34 | µg/ml | | | 10.3390/ijms18122575 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-23 |
| 1259 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLFDLIWGFVGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYRIYSEAFREWEADPTNPALREEMRIQFNDMNSALVTALPLFSVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDVATINSRYNDLTRNIGEYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIISLFPNYDSRTYPIRTVAQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGLSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGNN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYNLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCGEPNR
CAPQLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLLGEALARVK
RAEKKWRDKREKLELETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEE
LEGRIFTAYSLYDARNVIKNGDFNNGLSCWNVKGHVAVEEQHNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGY
GEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYT
DGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 47761 | Cry1Ab37 | No | Not applicable | Coleoptera | Leptinotarsa decemlineata | No | 7539 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | | | Described as axmi112 in patent | Colin Berry | 2024-02-14 |
| 1260 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLFDLIWGFVGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYRIYSEAFREWEADPTNPALREEMRIQFNDMNSALVTALPLFSVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDVATINSRYNDLTRNIGEYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIISLFPNYDSRTYPIRTVAQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGLSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGNN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYNLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCGEPNR
CAPQLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLLGEALARVK
RAEKKWRDKREKLELETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEE
LEGRIFTAYSLYDARNVIKNGDFNNGLSCWNVKGHVAVEEQHNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGY
GEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYT
DGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 47757 | Cry1Ab37 | No | Not applicable | Rhabditida | Caenorhabditis elegans | No | 6239 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | | | Described as axmi112 in patent | Colin Berry | 2024-10-02 |
| 1261 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLFDLIWGFVGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYRIYSEAFREWEADPTNPALREEMRIQFNDMNSALVTALPLFSVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDVATINSRYNDLTRNIGEYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIISLFPNYDSRTYPIRTVAQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGLSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGNN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYNLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCGEPNR
CAPQLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLLGEALARVK
RAEKKWRDKREKLELETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEE
LEGRIFTAYSLYDARNVIKNGDFNNGLSCWNVKGHVAVEEQHNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGY
GEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYT
DGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 47763 | Cry1Ab37 | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | | US patent 8461421 | | | | | Described as axmi112 in patent | Colin Berry | 2024-02-16 |
| 1262 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLFDLIWGFVGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYRIYSEAFREWEADPTNPALREEMRIQFNDMNSALVTALPLFSVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDVATINSRYNDLTRNIGEYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIISLFPNYDSRTYPIRTVAQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGLSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGNN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYNLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCGEPNR
CAPQLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLLGEALARVK
RAEKKWRDKREKLELETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEE
LEGRIFTAYSLYDARNVIKNGDFNNGLSCWNVKGHVAVEEQHNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGY
GEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYT
DGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 47762 | Cry1Ab37 | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | | | | | | US patent 8461421 | | | | | 75% mortlity under assay conditions. Described as axmi112 in patent | Colin Berry | 2024-02-15 |
| 1263 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLFDLIWGFVGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYRIYSEAFREWEADPTNPALREEMRIQFNDMNSALVTALPLFSVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDVATINSRYNDLTRNIGEYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIISLFPNYDSRTYPIRTVAQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGLSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGNN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYNLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCGEPNR
CAPQLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLLGEALARVK
RAEKKWRDKREKLELETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEE
LEGRIFTAYSLYDARNVIKNGDFNNGLSCWNVKGHVAVEEQHNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGY
GEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYT
DGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 47760 | Cry1Ab37 | No | Not applicable | Lepidoptera | Heliothis virescens | No | 7102 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | | | possible stunting. Described as axmi112 in patent | Colin Berry | 2024-02-13 |
| 1264 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLFDLIWGFVGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYRIYSEAFREWEADPTNPALREEMRIQFNDMNSALVTALPLFSVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDVATINSRYNDLTRNIGEYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIISLFPNYDSRTYPIRTVAQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGLSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGNN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYNLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCGEPNR
CAPQLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLLGEALARVK
RAEKKWRDKREKLELETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEE
LEGRIFTAYSLYDARNVIKNGDFNNGLSCWNVKGHVAVEEQHNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGY
GEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYT
DGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 47759 | Cry1Ab37 | No | Not applicable | Lepidoptera | Helicoverpa zea | No | 7113 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | | | Possible mild stunting. Described as axmi112 in patent | Colin Berry | 2024-12-02 |
| 1265 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLFDLIWGFVGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYRIYSEAFREWEADPTNPALREEMRIQFNDMNSALVTALPLFSVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDVATINSRYNDLTRNIGEYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIISLFPNYDSRTYPIRTVAQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGLSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGNN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYNLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCGEPNR
CAPQLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLLGEALARVK
RAEKKWRDKREKLELETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEE
LEGRIFTAYSLYDARNVIKNGDFNNGLSCWNVKGHVAVEEQHNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGY
GEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYT
DGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 47758 | Cry1Ab37 | No | Not applicable | Lepidoptera | Diatraea grandiosella | Yes | 61289 | | | | | | US patent 8461421 | | | | | 25% mortality under assay conditions. Described as axmi112 in patent | Colin Berry | 2024-11-02 |
| 1266 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLFDLIWGFVGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYRIYSEAFREWEADPTNPALREEMRIQFNDMNSALVTALPLFSVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDVATINSRYNDLTRNIGEYTDYAVRWYNTGLERVWGPDSRDWVRYNQFRRELTLTV
LDIISLFPNYDSRTYPIRTVAQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGLSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGNN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYNLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCGEPNR
CAPQLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLLGEALARVK
RAEKKWRDKREKLELETNIVYKEAKESVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEE
LEGRIFTAYSLYDARNVIKNGDFNNGLSCWNVKGHVAVEEQHNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGY
GEGCVTIHEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYT
DGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 47756 | Cry1Ab37 | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | No | 129554 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | | US patent 8461421 | | | | | possible stunting. Described as axmi112 in patent | Colin Berry | 2024-09-02 |
| 1267 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 139017 | Cry1Ab5 | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 6.8 | ng/cm2 | | | 10.1073/pnas.85.21.7844 | | Larvae | 1st instar | | Diet incorporation | Toxin described in publication as Bt2 | Colin Berry | 2025-09-04 |
| 1268 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137758 | Cry1Ab5 | No | Not applicable | Lepidoptera | Spodoptera exempta | Yes | 134406 | | | | 0.34 | 10.1006/jipa.1993.1101 | | Larvae | 1st instar | Purified protein | Leaf dip | | Colin Berry | 2025-09-04 |
| 1269 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138174 | Cry1Ab5 | No | Not applicable | Lepidoptera | Pieris brassicae | Yes | 7116 | 0.7 | µg/ml | | | 10.1128/aem.54.8.2010-2017.1988 | | Larvae | | Purified protein | | Cry1Ab5 is described in paper as Bt2 | Colin Berry | 2025-09-04 |
| 1270 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138176 | Cry1Ab5 | No | Not applicable | Lepidoptera | Spodoptera littoralis | No | 7109 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/aem.54.8.2010-2017.1988 | | Larvae | 1st instar | Purified protein | Surface contamination | Cry1Ab5 is described in paper as Bt2 | Colin Berry | 2025-09-04 |
| 1271 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138178 | Cry1Ab5 | No | Not applicable | Lepidoptera | Mamestra brassicae | Yes | 55057 | 162.4 | ng/cm2 | | | 10.1128/aem.54.8.2010-2017.1988 | | Larvae | 1st instar | Purified protein | Surface contamination | Cry1Ab5 is described in paper as Bt2 | Colin Berry | 2025-09-04 |
| 1272 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138180 | Cry1Ab5 | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 8.6 | ng/cm2 | | | 10.1128/aem.54.8.2010-2017.1988 | | Larvae | | Purified protein | | Cry1Ab5 is described in paper as Bt2 | Colin Berry | 2025-09-04 |
| 1273 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129766 | Cry1Ab5 | No | Not applicable | Lepidoptera | Pieris brassicae | Yes | 7116 | 1.6 | ng/larva | | | 10.1111/j.1432-1033.1986.tb10443.x | | Larvae | 3rd Instar | | Leaf-dip | Described as Bt2 in the publication | Colin Berry | 2024-06-13 |
| 1274 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129765 | Cry1Ab5 | No | Not applicable | Lepidoptera | Pieris brassicae | Yes | 7116 | 0.9 | µg/ml | | | 10.1073/pnas.85.21.784 | | | | Purified protein | | Described as Bt2 in the publication | Colin Berry | 2024-06-13 |
| 1275 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129764 | Cry1Ab5 | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 6 | ng/cm2 | | | 10.1111/j.1432-1033.1986.tb10443.x | | Larvae | 1st Instar | | Diet incorporation | Described as Bt2 in the publication | Colin Berry | 2024-06-13 |
| 1276 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129763 | Cry1Ab5 | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 6.8 | ng/cm2 | | | 10.1073/pnas.85.21.784 | | | | Purified protein | | Described as Bt2 in the publication | Colin Berry | 2024-06-13 |
| 1277 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138182 | Cry1Ab5 | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | 10.7 | ng/cm2 | | | 10.1128/aem.54.8.2010-2017.1988 | | Larvae | 1st instar | Purified protein | Surface contamination | Cry1Ab5 is described in paper as Bt2 | Colin Berry | 2025-09-04 |
| 1278 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 139021 | Cry1Ab5 | No | Not applicable | Lepidoptera | Pieris brassicae | Yes | 7116 | 0.9 | ng/cm2 | | | 10.1073/pnas.85.21.7844 | | Larvae | 3rd instar | | Leaf dip | Toxin described in publication as Bt2 | Colin Berry | 2025-09-04 |
| 1279 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 46269 | Cry1Ab5 | No | Not applicable | Lepidoptera | Leucoptera coffeella | No | 1178041 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1007/pl00006763 | | Larvae | 1st instar | Purified activated protein | Leaf disc injection | LC50>1000µg/ml. Species described in the publication under the old name Perileucoptera coffeella | Jakub Baranek | 2023-01-14 |
| 1280 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSANFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIHGRPINQGNFSATMSSGSN
LQSGSFRHLGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKEELSEKVKHANGLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGILEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGTGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYGGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129767 | Cry1Ab6 | No | Not applicable | Lepidoptera | Actebia fennica | No | 989868 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/aem.63.10.4132-4134.1997 | | larvae | 5th instar | Purified protein | Force feeding | Toxin activated with Bombyx mori gut juice. Not toxic with ED50 >2269ng/larva | Colin Berry | 2024-06-13 |
| 1281 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSANFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIHGRPINQGNFSATMSSGSN
LQSGSFRHLGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKEELSEKVKHANGLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGILEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGTGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYGGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129768 | Cry1Ab6 | No | Not applicable | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | 20.4 | ng/larva | | | 10.1128/aem.63.10.4132-4134.1997 | | larvae | 6th instar | Purified protein | Force feeding | Toxin activated with Bombyx mori gut juice. Toxicity expressed as FFD50 | Colin Berry | 2024-06-13 |
| 1282 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSANFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIHGRPINQGNFSATMSSGSN
LQSGSFRHLGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKEELSEKVKHANGLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGILEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGTGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYGGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 129769 | Cry1Ab6 | No | Not applicable | Lepidoptera | Lymantria dispar | Yes | 13123 | 46.8 | ng/larva | | | 10.1128/aem.63.10.4132-4134.1997 | | larvae | 4th instar | Purified protein | Force feeding | Toxin activated with Bombyx mori gut juice. Toxicity expressed as ED50 | Colin Berry | 2024-06-13 |
| 1283 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRPPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQLHTSIDGRIINQGNFSATMSSGSN
LQSGSFRIVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138713 | Cry1Ab7 | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | | | | | 10.1111/j.1365-2958.1987.tb00527.x | | Cells in culture | | Purified inclusions | Addition to cultured cells | Active when activated by trypsin but not when activated with Aedes aegypti gut proteinases | Colin Berry | 2025-09-04 |
| 1284 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRPPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQLHTSIDGRIINQGNFSATMSSGSN
LQSGSFRIVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138714 | Cry1Ab7 | No | Not applicable | Diptera | Aedes albopictus | Yes | 7160 | | | | | 10.1111/j.1365-2958.1987.tb00527.x | | Cells in culture | | Purified inclusions | Addition to cultured cells | More toxic when activated with Aedes aegypti gut proteinases than when activated with trypsin | Colin Berry | 2025-09-04 |
| 1285 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRPPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQLHTSIDGRIINQGNFSATMSSGSN
LQSGSFRIVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 46388 | Cry1Ab7 | No | Not applicable | Diptera | Aedes aegypti | Yes | 7159 | | | | 100% mortality at 10 µg/ml | 10.1016/0378-1119(87)90055-2 | | Larvae | Not Specified | Purified protein | Diet incorporation | Mortality observed after 24 hours | Alexander Wall | 2023-05-13 |
| 1286 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRPPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQLHTSIDGRIINQGNFSATMSSGSN
LQSGSFRIVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 46389 | Cry1Ab7 | No | Not applicable | Lepidoptera | Pieris brassicae | Yes | 7116 | | | | 50% mortality at 10 µg/ml | 10.1016/0378-1119(87)90055-2 | | Larvae | Not Specified | Purified protein | Diet incorporation | Mortality observed after 20 hours | Alexander Wall | 2023-05-14 |
| 1287 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRPPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQLHTSIDGRIINQGNFSATMSSGSN
LQSGSFRIVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYLTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWRLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 138712 | Cry1Ab7 | No | Not applicable | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | | | | | 10.1111/j.1365-2958.1987.tb00527.x | | Cells in culture | | Purified inclusions | Addition to cultured cells | Assay using CF1 cells. Active when activated by trypsin but not when activated with Aedes aegypti gut proteinases | Colin Berry | 2025-09-04 |
| 1288 | MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVLGLVDIIWGIFGPSQWDAFLVQI
EQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREWEADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSV
YVQAANLHLSVLRDVSVFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRELTLTV
LDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRALAQGIEGSIRSPHLMDILNSITIYTDAHRGEYYWSGHQ
IMASPVGFSGPEFTFPLYGTMGNAAPQQRIVAQLGQGVYRTLSSTLYRRPFNIGINNQQLSVLDGTEFAYGTSSNLPSAV
YRKSGTVDSLDEIPPQNNNVPPRQGFSHRLSHVSMFRSGFSNSSVSIIRAPMFSWIHRSAEFNNIIPSSQITQIPLTKST
NLGSGTSVVKGPGFTGGDILRRTSPGQISTLRVNITAPLSQRYRVRIRYASTTNLQFHTSIDGRPINQGNFSATMSSGSN
LQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDV
TDYHIDQVSNLVECLSDEFCLDEKKELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYV
TLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAPSPIGKCAHHSH
HFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKE
SVDALFVNSQYDRLQADTNIAMIHAADKRVHSIREAYLPELSVIPGVNAAIFEELEGRIFTAFSLYDARNVIKNGDFNNG
LSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNFVEEE
VYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVT
KELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
| 137913 | Cry1Ab8 | No | Not applicable | Lepidoptera | Bombyx mori | Yes | 7091 | 12.63 | ppm | | | 10.1016/j.ibmb.2023.104030 | | Larvae | | Inclusion bodies | Surface contamination | | Colin Berry | 2025-09-04 |
| 1289 | | 129770 | Cry1AbH589A | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 276 | ng/cm2 | | | 10.1128/AEM.01580-20 | | Larvae | Not specified | Spore crystal mix | Surface contamination | Sf-IBT isolate Sf-IBT 276ng/cm5 | Colin Berry | 2024-06-13 |
| 1290 | | 47343 | Cry1AbMod | No | Not applicable | Lepidoptera | Pectinophora gossypiella | Yes | 13191 | 1070 | ng/ml | | | 10.1371/journal.pone.0080496 | | Larvae | 1st instar | Spore crystal mix | diet incorporation | Cry1Abmod lacks residues 1-56 (including domain 1 N-terminal helix) | Jakub Baranek | 2024-12-23 |
| 1291 | | 129771 | Cry1AbN514A-S587A | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 75-660 | ng/cm2 | | | 10.1128/AEM.01580-20 | | Larvae | Not specified | Spore crystal mix | Surface contamination | Strain dependent toxicity: Sf-UAEM1 strain 75ng/cm2; SfS-Mex 476ng/cm2; Sf-La Laguna 411ng/cm2; Sf-Valle del Fuerte 660ng/cm2 | Colin Berry | 2024-06-13 |
| 1292 | | 129772 | Cry1AbS587A | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 34-2420 | ng/cm2 | | | 10.1128/AEM.01580-20 | | Larvae | Not specified | Spore crystal mix | Surface contamination | Strain dependent toxicity: Sf-UAEM1 strain 34ng/cm2; SfS-Mex 169ng/cm2; Sf-La Laguna 1481ng/cm2; Sf-Valle del Fuerte 2420ng/cm2; Sf-IBT 44ng/cm4 | Colin Berry | 2024-06-13 |
| 1293 | | 129773 | Cry1AbT585A | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 89 | ng/cm2 | | | 10.1128/AEM.01580-20 | | Larvae | Not specified | Spore crystal mix | Surface contamination | Sf-IBT isolate 89ng/cm3 | Colin Berry | 2024-06-13 |
| 1294 | | 129774 | Cry1AbV583A | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 175 | ng/cm2 | | | 10.1128/AEM.01580-20 | | Larvae | Not specified | Spore crystal mix | Surface contamination | Sf-IBT isolate 175ng/cm2 | Colin Berry | 2024-06-13 |
| 1295 | | 129775 | Cry1AbV590A | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 187 | ng/cm2 | | | 10.1128/AEM.01580-20 | | Larvae | Not specified | Spore crystal mix | Surface contamination | Sf-IBT isolate Sf-IBT 187ng/cm6 | Colin Berry | 2024-06-13 |
| 1296 | | 138940 | Cry1Abmod | No | Not applicable | Lepidoptera | Trichoplusia ni | Yes | 7111 | 0.62 | mg/cm2 | | | 10.1128/AEM.00664-09 | | Larvae | 3rd instar | | Surface contamination | Cry1Abmod lacks residues 1-56 (including domain 1 N-terminal helix) | Colin Berry | 2025-09-04 |
| 1297 | | 138944 | Cry1Abmod | No | Not applicable | Lepidoptera | Pectinophora gossypiella | Yes | 13191 | 0.39 | µg/ml | | | 10.1126/science.1146453 | | Larvae | | | | Cry1Abmod lacks residues 1-56 (including domain 1 N-terminal helix) | Colin Berry | 2025-09-04 |
| 1298 | | 47361 | Cry1Abmod | No | Not applicable | Lepidoptera | Spodoptera frugiperda | Yes | 7108 | 60 | ng/cm2 | | | 10.1371/journal.pone.0119544 | | Larvae | 2nd Instar | Spore crystal mix | Surface contamination | Cry1Abmod lacks residues 1-56 (including domain 1 N-terminal helix) | Chloe Tucker | 2024-10-01 |
| 1299 | | 49660 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.05 - 0.121 | µg/ml | | | 10.1371/journal.ppat.1008697 | | Larvae | 3rd Instar | Not specified | Surface contamination | Range of LC50 over different assays described for Px strain G88. Assay method: protoxin were distributed over the surface of the diet | Jorge Zimmermann | 2023-04-21 |
| 1300 | | 138285 | Cry1Ac | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | 0.11 | ng/mm2 | | | 10.1128/jb.173.13.3966-3976.1991 | | Larvae | 1st instar | Spore and/or crystal suspension | Surface contamination | | Colin Berry | 2025-09-04 |
| 1301 | | 138286 | Cry1Ac | No | Not applicable | Lepidoptera | Spodoptera exigua | No | 7107 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/jb.173.13.3966-3976.1991 | | Larvae | 1st instar | Spore and/or crystal suspension | Surface contamination | No signigicant toxicity at highest dose tested 57ng/mm2 | Colin Berry | 2025-09-04 |
| 1302 | | 132762 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.116 | µg/ml | | | | CN102559554A | larvae | 3rd instar | | Leaf-dip | | Victoria Valby | 2023-12-18 |
| 1303 | | 132761 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 2.21 | µg/ml | | | | CN102559554A | larvae | | | Diet incorporation | | Victoria Valby | 2023-12-18 |
| 1304 | | 137899 | Cry1Ac | No | Not applicable | Lepidoptera | Ostrinia nubilalis | Yes | 29057 | 5.4 | ng/cm2 | | | 10.1016/j.cropro.2011.05.009 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1305 | | 137900 | Cry1Ac | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | 2.8 | ng/cm2 | | | 10.1016/j.cropro.2011.05.009 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1306 | | 137901 | Cry1Ac | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | 1.2 | ng/cm2 | | | 10.1016/j.cropro.2011.05.009 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1307 | | 137909 | Cry1Ac | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | 0.11 | µg/g | | | 10.1016/j.cropro.2025.107216 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1308 | | 137664 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | 1 | 10.1093/jisesa/ieu054 | | Larvae | 2nd instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1309 | | 48947 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 15 | picomolar | | | 10.1128/AEM.67.9.4372-4373.2001 | | Larvae | 3rd Instar | Other (add to comments) | Leaf-dip | Crystals, in vitro solubilized and activated Cry1Ac tested against a sensitive isolate of P. xylostella (Roth). Field resistant (UNSEL) and this strain further selected (SEL) is also reported (LC50 higher). In addition to LC50 in pM, LC50 ranging from 0.003-0.111 mg/ml also reported for crystals/spore crystal mixes | Jorge Zimmermann | 2023-04-21 |
| 1310 | | 137953 | Cry1Ac | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | 5.1 | ng/cm2 | | | 10.1016/j.jip.2015.01.013 | | Larvae | 1st instar | Purified protein | | | Colin Berry | 2025-09-04 |
| 1311 | | 139242 | Cry1Ac | No | Not applicable | Lepidoptera | Lymantria dispar | No | 13123 | N/A, not toxic | N/A, not toxic | NA | N/A, not toxic | 10.1128/AEM.67.9.3923-3927.2001 | | Larvae | 4th or 5th instar | Purified protein | Injection or force feeding | Injection produced no feeding inhibition; Forced feeding, frass feeding dose 2484.0 ng/larva; cell mortality 73.2% (control 26.4%) | Colin Berry | 2025-10-14 |
| 1312 | | 137959 | Cry1Ac | No | Not applicable | Lepidoptera | Adoxophyes orana | Yes | 480707 | 209 | ng/g | | | 10.1016/j.jip.2016.06.004 | | Larvae | 1st instar | Partially purified inclusion bodies | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1313 | | 130363 | Cry1Ac | No | Not applicable | Sarcoptiformes | Oppia nitens | No | 1686743 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1093/jee/90.1.113 | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-08-07 |
| 1314 | | 130364 | Cry1Ac | No | Not applicable | Sarcoptiformes | Scheloribates praeincisus | No | Not available | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1007/s10493-007-9059-0 | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-08-07 |
| 1315 | | 46270 | Cry1Ac | No | Not applicable | Lepidoptera | Leucoptera coffeella | Yes | 1178041 | 1.47 | µg/ml | | | 10.1007/pl00006763 | | Larvae | 1st instar | Purified activated protein | Leaf disc injection | Species described in the publication under the old name Perileucoptera coffeella | Jakub Baranek | 2023-01-15 |
| 1316 | | 129793 | Cry1Ac | No | Not applicable | Lepidoptera | Danaus plexippus | Yes | 13037 | 13.8 | ng/ml | | | 10.1073/pnas.211297698 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2024-06-13 |
| 1317 | | 137988 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | 2.2 | ng/ml | | | 10.1016/j.yrtph.2018.09.003 | | Larvae | | | | | Colin Berry | 2025-09-04 |
| 1318 | | 138655 | Cry1Ac | No | Not applicable | Lepidoptera | Eldana saccharina | Yes | 236776 | | | | | 10.5897/AJMR12.867 | | Larvae | 1st and second instar | Transgenic plant | Transgenic plant | Higher than control mortality and reductin in surviving larval weight | Colin Berry | 2025-09-04 |
| 1319 | | 137990 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 0.24 | µg/ml | | | 10.1016/S0261-2194(02)00044-3 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1320 | | 130354 | Cry1Ac | No | Not applicable | Poduromorpha | Xenylla grisea | No | 187712 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/S0031-4056(24)00312-3 | | | | Purified protein | Diet incorporation | | Colin Berry | 2024-07-25 |
| 1321 | | 130351 | Cry1Ac | No | Not applicable | Neuroptera | Chrysoperla nipponensis | No | 413239 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3390/plants11202755 | | | | Purified protein | | Target refered to as Chrysopa sinica in publication, now renamed. No toxicity at 5ng/g purified protein | Colin Berry | 2024-08-08 |
| 1322 | | 130347 | Cry1Ac | No | Not applicable | Mesostigmata | Neoseiulus californicus | No | 84382 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1078/1439-1791-00024 | | | | Other | Other | Fed with Tetranychus urticae, prefed with toxin | Colin Berry | 2024-08-07 |
| 1323 | | 139187 | Cry1Ac | No | Not applicable | Lepidoptera | Achaea janata | Yes | 378752 | 23.7 | ng/cm2 | | | 10.1042/BJ20070054 | | Larvae | 2nd instar | Purified protein | Leaf-dip | | Colin Berry | 2025-10-14 |
| 1324 | | 133583 | Cry1Ac | No | Not applicable | Diptera | Episyrphus balteatus | No | 286459 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.ijbiomac.2024.137995 | | Larvae | 1st Instar | Other | Other | Insects fed with Aphis gossypii, pre-fed with Cry1Actransgenic cotton | Colin Berry | 2025-01-13 |
| 1325 | | 137821 | Cry1Ac | No | Not applicable | Lepidoptera | Cnaphalocrocis patnalis | Yes | 1591229 | 19.88 | ng/cm2 | | | 10.1007/s002840010134 | | Larvae | | | Leaf dip | Three day old larvae used. Insect described using synonym Marasmia patnalis | Colin Berry | 2025-09-04 |
| 1326 | | 137817 | Cry1Ac | No | Not applicable | Lepidoptera | Cnaphalocrocis medinalis | Yes | 437488 | 21.11 | ng/cm2 | | | 10.1007/s002840010134 | | Larvae | | | Leaf dip | Three day old larvae used | Colin Berry | 2025-09-04 |
| 1327 | | 129820 | Cry1Ac | No | Not applicable | Lepidoptera | Tuta absoluta | Yes | 702717 | 0.12µg/ml | | | | 10.1186/s41938-020-00283-4 | | Larvae | | Purified protein | Surface contamination | 2nd instar LC50 0.12µg/ml, 3rd instar 0.27µg/ml 4th instar 0.43µg/ml | Colin Berry | 2024-08-03 |
| 1328 | | 137994 | Cry1Ac | No | Not applicable | Lepidoptera | Earias vittella | Yes | 1372994 | 0.884 | ng/cm2 | | | 10.1016/S0261-2194(99)00058-7 | | Larvae | 1st instar | Purified protein | Leaf dip | Mean LC50 presented with some variation depending on region of origin of larvae | Colin Berry | 2025-09-04 |
| 1329 | | 137998 | Cry1Ac | No | Not applicable | Lepidoptera | Rachiplusia nu | Yes | 708043 | | | | 1 | 10.1017/S0007485325000069 | | Larvae | | Transgenic plant | Transgenic plant | Mon87701 expressing Cry1Ac used | Colin Berry | 2025-09-04 |
| 1330 | | 138025 | Cry1Ac | No | Not applicable | Hemiptera | Nilaparvata lugens | No | 108931 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-02207-z | | | | | | | Colin Berry | 2025-09-04 |
| 1331 | | 138028 | Cry1Ac | No | Not applicable | Araneae | Pardosa pseudoannulata | No | 330961 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1038/s41598-017-02207-z | | | | | | | Colin Berry | 2025-09-04 |
| 1332 | | 129819 | Cry1Ac | No | Not applicable | Lepidoptera | Trichoplusia ni | Yes | 7111 | 0.129 | mg/l | | | 10.1128/AEM.02079-06 | | Larvae | 1st Instar | Purified protein | Surface contamination | IC50 reported. Cry1Ac resistant strain data also included in paper | Colin Berry | 2024-06-13 |
| 1333 | | 129818 | Cry1Ac | No | Not applicable | Lepidoptera | Thaumetopoea pityocampa | Yes | 208016 | 379 | pg/µl | | | 10.1128/AEM.66.4.1553-1558.2000 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-23 |
| 1334 | | 138043 | Cry1Ac | No | Not applicable | Lepidoptera | Scirpophaga incertulas | Yes | 72366 | | | | 75.9 to 92.4% | 10.1073/pnas.94.6.2111 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1335 | | 138044 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | | | | 38 to 46% | 10.1073/pnas.94.6.2111 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1336 | | 138047 | Cry1Ac | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | | | | 1 | 10.1073/pnas.95.6.2767 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1337 | | 138048 | Cry1Ac | No | Not applicable | Lepidoptera | Scirpophaga incertulas | Yes | 72366 | | | | 1 | 10.1073/pnas.95.6.2767 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | | Colin Berry | 2025-09-04 |
| 1338 | | 138049 | Cry1Ac | No | Not applicable | Lepidoptera | Epiphyas postvittana | Yes | 65032 | 434 | nl E.coli extract/ml | | | 10.1080/01140671.1992.10422323 | | Larvae | 1st instar | Cell lysate | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1339 | | 138050 | Cry1Ac | No | Not applicable | Lepidoptera | Planotortrix octo | Yes | 65038 | 149 | nl E.coli extract/ml | | | 10.1080/01140671.1992.10422323 | | Larvae | 1st instar | Cell lysate | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1340 | | 138051 | Cry1Ac | No | Not applicable | Lepidoptera | Ctenopseustis obliquana | Yes | 65030 | 144 | nl E.coli extract/ml | | | 10.1080/01140671.1992.10422323 | | Larvae | 1st instar | Cell lysate | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1341 | | 138062 | Cry1Ac | No | Not applicable | Hemiptera | Myzus persicae | No | 13164 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1111/eea.12419 | | Adult | | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1342 | | 138064 | Cry1Ac | No | Not applicable | Hemiptera | Brevicoryne brassicae | No | 69196 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1111/eea.12419 | | Adult | | Purified protein | Diet incorporation | Some effects on net populatoin growth rates, no effect on survival | Colin Berry | 2025-09-04 |
| 1343 | | 139184 | Cry1Ac | No | Not applicable | Coleoptera | Tribolium castaneum | No | 7070 | N/A, not toxic | N/A, not toxic | NA | N/A, not toxic | 10.1016/j.dci.2015.02.005 | | Larvae | | Spore/crystal mix | Diet incorporation | 10-14 day old larvae used | Colin Berry | 2025-10-14 |
| 1344 | | 138086 | Cry1Ac | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | 0.41 | µg/g | | | 10.1111/j.1574-6968.2007.01053.x | | Larvae | 1st instar | Spore and/or crystal suspension | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1345 | | 138089 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 7.15 | µg/g | | | 10.1111/j.1574-6968.2007.01053.x | | Larvae | 1st instar | Spore and/or crystal suspension | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1346 | | 138091 | Cry1Ac | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 5.87 | µg/g | | | 10.1111/j.1574-6968.2007.01053.x | | Larvae | 1st instar | Spore and/or crystal suspension | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1347 | | 138092 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 1.86 | µg/g | | | 10.1111/j.1574-6968.2007.01053.x | | Larvae | 2nd instar | Spore and/or crystal suspension | Leaf dip | | Colin Berry | 2025-09-04 |
| 1348 | | 129817 | Cry1Ac | No | Not applicable | Lepidoptera | Thaumetopoea pityocampa | Yes | 208016 | 379 | | | | 10.1006/pest.1999.2426 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-06-13 |
| 1349 | | 138138 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 123 | ng/cm2 | | | 10.1128/AEM.01373-08 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2025-09-04 |
| 1350 | | 138142 | Cry1Ac | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 38.69 | | | | 10.1128/AEM.01544-14 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1351 | | 138143 | Cry1Ac | No | Not applicable | Lepidoptera | Sesamia inferens | Yes | 492764 | 782.11 | | | | 10.1128/AEM.01544-14 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1352 | | 138157 | Cry1Ac | No | Not applicable | Lepidoptera | Earias insulana | Yes | 1231953 | 1.1 | µg/ml | | | 10.1128/AEM.02861-05 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1353 | | 129816 | Cry1Ac | No | Not applicable | Lepidoptera | Thaumatotibia leucotreta | Yes | 463830 | 7.58 | ng | | | 10.1016/j.cropro.2011.09.019 | | Larvae | 1st instar | Other | Other (add to comments) | Droplet feeding assay using semi purified inclusion bodies from E. coli expression. LD50 values reported | Colin Berry | 2024-07-29 |
| 1354 | | 129815 | Cry1Ac | No | Not applicable | Lepidoptera | Rachiplusia nu | Yes | 708043 | | | | 100% mortality | 10.1038/s41598-021-00770-0 | | Larvae | 1st instar | Transgenic plant | Transgenic plant | 100% mortality for Argenina population but no toxicity for Brazilian population that may have developed resistance | Colin Berry | 2024-06-13 |
| 1355 | | 129814 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.008-0.08 | µg per 15mg diet | | | 10.1016/j.jspr.2010.01.003 | | larvae | 1st instar | | Surface contamination | Higher LC50 for resistant colonies also reported | Colin Berry | 2024-06-13 |
| 1356 | | 129813 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 1.556 | µg/ml | | | 10.1007/s002849900438 | | Larvae | 3rd Instar | Purified protein | Leaf-dip | LC50 for 5 days presented (paper also has LC50 at 2 days) | Colin Berry | 2024-06-13 |
| 1357 | | 129812 | Cry1Ac | No | Not applicable | Lepidoptera | Platynota stultana | Yes | 708047 | 7.1 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1358 | | 129811 | Cry1Ac | No | Not applicable | Lepidoptera | Pieris brassicae | No | 7116 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1073/pnas.85.21.784 | | | | Purified protein | | From strain HD73 | Colin Berry | 2024-06-13 |
| 1359 | | 129810 | Cry1Ac | No | Not applicable | Lepidoptera | Pectinophora gossypiella | Yes | 13191 | 0.04x10(8) | cells/g | | | 10.1007/s00203-007-0285-y | | Larvae | 1st instar | Vegetative cells | Diet incorporation | LC50 from 0.04x10(8) to 0.27x10(8) cells/g depending on promoter used for expression | Colin Berry | 2024-06-13 |
| 1360 | | 129809 | Cry1Ac | No | Not applicable | Lepidoptera | Pandemis pyrusana | Yes | 1144657 | 1.6 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1361 | | 129808 | Cry1Ac | No | Not applicable | Lepidoptera | Orgyia leucostigma | Yes | 95259 | 560 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1362 | | 129807 | Cry1Ac | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 12.5 | ng total protein | | | 10.1128/aem.57.6.1650-1655.1991 | | Cultured cells | | Purified protein | Addition to cell culture | | Colin Berry | 2024-07-19 |
| 1363 | | 129806 | Cry1Ac | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 0.1 | ng/cm2 | | | 10.1074/jbc.C200263200 | | Larvae | 1st instar | | Surface contamination | | Colin Berry | 2024-06-13 |
| 1364 | | 129805 | Cry1Ac | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 5.3 | ng/cm2 | | | 10.1073/pnas.85.21.784 | | | | Purified protein | | From strain HD73 | Colin Berry | 2024-06-13 |
| 1365 | | 129804 | Cry1Ac | No | Not applicable | Lepidoptera | Manduca sexta | Yes | 7130 | 0.0039 | µg/cm2 | | | 10.1016/j.jip.2008.03.012 | | Larvae | 1st Instar | Purified crystals | Surface contamination | | Colin Berry | 2024-06-13 |
| 1366 | | 129803 | Cry1Ac | No | Not applicable | Lepidoptera | Malacosoma disstria | Yes | 40071 | 26.5 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1367 | | 129802 | Cry1Ac | No | Not applicable | Lepidoptera | Lymantria monacha | Yes | 78897 | | | | | 10.1128/AEM.66.4.1553-1558.2000 | | Larvae | 2nd instar | Purified protein | Surface contamination | Inhibition of molting from 2nd to 3rd instar at 200ng/cm2: no significant mortality | Colin Berry | 2024-07-23 |
| 1368 | | 129797 | Cry1Ac | No | Not applicable | Lepidoptera | Diatraea tabernella | Yes | 2026894 | | µg/cm2 | | >90% | 10.1371/journal.pone.0292992 | | Larvae | 1st Instar | Other (add to comments) | Other (add to comments) | >90% toxicity at 24.1µg/cm2. Cry1Ac protein solubilised from crystal preparation from Bt HD73 and trypsin activated, assayed on cob corn discs | Colin Berry | 2024-06-13 |
| 1369 | | 129776 | Cry1Ac | No | Not applicable | Lepidoptera | Tecia solanivora | Yes | 396680 | 0.107 | µg/cm2 | | | Rev. colomb. biotecnol [online]. 2008, vol.10, n.2, pp.85-96. | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-19 |
| 1370 | | 46207 | Cry1Ac | No | Not applicable | Lepidoptera | Agrotis ipsilon | Yes | 56364 | 16.5 | µg/cm2 | | | 10.1002/ps.1798 | | | | Purified protein | surface contamination | | Jakub Baranek | 2022-11-13 |
| 1371 | | 47416 | Cry1Ac | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | 0.75 | ng/cm2 | | | 10.1590/S0100-204X2014000200001 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-06-03 |
| 1372 | | 47048 | Cry1Ac | No | Not applicable | Lepidoptera | Chilo partellus | Yes | 236792 | 16.31 | ng/cm2 | | | 10.1111/j.1472-765X.2010.02856.x | | Larvae | 4th instar | Purified protein | surface contamination | | Jakub Baranek | 2024-03-03 |
| 1373 | | 46507 | Cry1Ac | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 4360 | ng/g | | | 10.1016/j.jip.2010.05.002 | | unknown | | Purified protein | diet incorporation | | Jakub Baranek | 2023-09-09 |
| 1374 | | 47417 | Cry1Ac | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | 13.3 | ng/cm2 | | | 10.1590/S0100-204X2014000200001 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-07-03 |
| 1375 | | 47542 | Cry1Ac | No | Not applicable | Lepidoptera | Diatraea flavipennella | Yes | 1813784 | 8.6 | ng/cm2 | | | 10.7717/peerj.2866 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-10-07 |
| 1376 | | 46407 | Cry1Ac | No | Not applicable | Lepidoptera | Earias insulana | Yes | 1231953 | 0.35 | µg/ml | | | 10.1016/j.biocontrol.2008.07.003 | | Larvae | 1st instar | Purified crystals | diet incorporation | LC50 of 350 ng/ml and 490 ng/ml in repeat assays. Growth inhibition data EC50 values also presented | Jakub Baranek | 2023-01-06 |
| 1377 | | 47543 | Cry1Ac | No | Not applicable | Lepidoptera | Elasmopalpus lignosellus | Yes | 1511197 | 15.6 | ng/cm2 | | | 10.7717/peerj.2866 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-11-07 |
| 1378 | | 46404 | Cry1Ac | No | Not applicable | Lepidoptera | Ephestia kuehniella | Yes | 40079 | 1326 | ng/mg | | | 10.1016/j.biocontrol.2005.06.009 | | Larvae | 3rd instar | Spore crystal mix | diet incorporation | | Jakub Baranek | 2023-05-29 |
| 1379 | | 46472 | Cry1Ac | No | Not applicable | Lepidoptera | Epinotia aporema | Yes | 437486 | 1390 | ng/ml | | | 10.1016/j.jip.2006.09.002 | | Larvae | 1st Instar | Purified crystals | diet incorporation | | Jakub Baranek | 2023-05-08 |
| 1380 | | 46596 | Cry1Ac | No | Not applicable | Lepidoptera | Grapholita molesta | Yes | 192188 | 24 | ng/cm2 | | | 10.1016/j.jip.2016.09.006 | | Larvae | 1st Instar | Purified crystals | surface contamination | | Jakub Baranek | 2023-07-12 |
| 1381 | | 46278 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 8800 | ng/ml | | | 10.1007/s00253-009-1910-2 | | Larvae | 1st instar | Purified crystals | diet incorporation | | Jakub Baranek | 2023-01-23 |
| 1382 | | 46298 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 89.8691 | µg/ml | | | 10.1007/s00284-008-9112-1 | | Larvae | 1st instar | Spore crystal mix | diet incorporation | LC50 117.778 µg/ml at 48h; 89.8691 µg/ml at 72h | Jakub Baranek | 2023-12-02 |
| 1383 | | 46349 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 17 | ng/cm2 | | | 10.1007/s11248-017-0048-8 | | Larvae | 1st instar | Purified protein | surface contamination | LC50 for colonies with resistance to Cry1Ac also measured: % mortalities at different doses also reported | Jakub Baranek | 2023-04-04 |
| 1384 | | 46408 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 2270 | ng/ml | | | 10.1016/j.biocontrol.2008.07.003 | | Larvae | 1st instar | Purified crystals | diet incorporation | LC50 of 2.27 µg/ml and 3.63 g/ml in repeat assays. Growth inhibition data EC50 values also presented | Jakub Baranek | 2023-02-06 |
| 1385 | | 46570 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 0.04 | ng/larva | | | 10.1016/j.jip.2014.06.005 | | Larvae | 1st Instar | Purified crystals | droplet feeding | | Jakub Baranek | 2023-11-11 |
| 1386 | | 46862 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 33 | ng/cm2 | | | 10.1038/srep07714 | | Larvae | 1st instar | Purified crystals | surface contamination | LC50 28 ng/cm2 and 33 ng/cm2 in assays at different generations | Jakub Baranek | 2024-08-29 |
| 1387 | | 46208 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa zea | Yes | 7113 | 1.9 | µg/cm2 | | | 10.1002/ps.1798 | | | | Purified protein | surface contamination | | Jakub Baranek | 2022-11-14 |
| 1388 | | 47349 | Cry1Ac | No | Not applicable | Lepidoptera | Heliothis virescens | Yes | 7102 | 40 | ng/cm2 | | | 10.1371/journal.pone.0107196 | | Larvae | 1st instar | Purified crystals | surface contamination | | Jakub Baranek | 2024-12-29 |
| 1389 | | 47231 | Cry1Ac | No | Not applicable | Lepidoptera | Lymantria dispar | Yes | 13123 | 871 | ng/larva | | | 10.1128/AEM.62.2.583-586.1996 | | Larvae | 4th instar | Purified crystals | force feeding | | Jakub Baranek | 2024-02-09 |
| 1390 | | 47486 | Cry1Ac | No | Not applicable | Lepidoptera | Mythimna separata | Yes | 271217 | 3700 | ng/g | | | 10.3390/toxins10110454 | | Larvae | 1st instar | | diet incorporation | | Jakub Baranek | 2024-05-15 |
| 1391 | | 47688 | Cry1Ac | No | Not applicable | Lepidoptera | Earias vittella | Yes | 1372994 | 59 | µg/g | | | Pakistan Journal of Zoology Vol. 43, Iss. 3, pages 575-580 (2011) | | Larvae | 2nd instar | Purified protein | diet incorporation | | Jakub Baranek | 2024-03-12 |
| 1392 | | 47639 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 8 | µg/cm2 | | | Current Science (1998), 75(7) p663-664 | | Larvae | 1st instar | Purified protein | surface contamination | Results presented as EC50. Synergism with Cry1F reported | Jakub Baranek | 2024-10-15 |
| 1393 | | 47371 | Cry1Ac | No | Not applicable | Lepidoptera | Ostrinia furnacalis | Yes | 93504 | 3580 | ng/g | | | 10.1371/journal.pone.0168442 | | Larvae | 1st instar | | diet incorporation | | Jakub Baranek | 2024-01-20 |
| 1394 | | 47255 | Cry1Ac | No | Not applicable | Lepidoptera | Pectinophora gossypiella | Yes | 13191 | | | | 7.4% at 100 ng/g | 10.1128/AEM.67.1.462-463.2001 | | Larvae | 1st Instar | Diluted whole cell culture | diet incorporation | Mortality observed after 21 days | Jakub Baranek | 2024-09-26 |
| 1395 | | 47344 | Cry1Ac | No | Not applicable | Lepidoptera | Pectinophora gossypiella | Yes | 13191 | 363 | ng/ml | | | 10.1371/journal.pone.0080496 | | Larvae | 1st instar | Diluted whole cell culture | diet incorporation | | Jakub Baranek | 2024-12-24 |
| 1396 | | 46508 | Cry1Ac | No | Not applicable | Lepidoptera | Sesamia inferens | Yes | 492764 | 5090 | ng/g | | | 10.1016/j.jip.2010.05.002 | | unknown | | Purified protein | diet incorporation | | Jakub Baranek | 2023-10-09 |
| 1397 | | 46279 | Cry1Ac | No | Not applicable | Lepidoptera | Spodoptera exigua | Yes | 7107 | 6800 | ng/ml | | | 10.1007/s00253-009-1910-2 | | Larvae | 1st instar | Purified crystals | diet incorporation | | Jakub Baranek | 2023-01-24 |
| 1398 | | 46747 | Cry1Ac | No | Not applicable | Lepidoptera | Spodoptera exigua | No | 7107 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/S2095-3119(12)60050-1 | | Larvae | 1st Instar | Purified protein | surface contamination | LC50>40000ng/cm2 | Jakub Baranek | 2024-06-05 |
| 1399 | | 129798 | Cry1Ac | No | Not applicable | Lepidoptera | Epiphyas postvittana | Yes | 65032 | 14.7 | µg/ml | | | 10.1006/jipa.1997.4680 | | Larvae | Not specified | Purified protein | Diet incorporation | | Colin Berry | 2024-07-19 |
| 1400 | | 129801 | Cry1Ac | No | Not applicable | Lepidoptera | Lymantria dispar | Yes | 13123 | 2484 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1401 | | 129800 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 5.07 | ng/cm2 | | | 10.1093/jee/toaa236 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-19 |
| 1402 | | 129799 | Cry1Ac | No | Not applicable | Lepidoptera | Helicoverpa armigera | Yes | 29058 | 0.09x10(8) | cells/ml | | | 10.1007/s00203-007-0285-y | | Larvae | 1st instar | Vegetative cells | Leaf-dip | LC50 from 0.09x10(8) to 1.57x10(8) cells/ml depending on promoter used for expression | Colin Berry | 2024-06-13 |
| 1403 | | 129796 | Cry1Ac | No | Not applicable | Lepidoptera | Diatraea saccharalis | Yes | 40085 | | µg/cm2 | | >90% | 10.1371/journal.pone.0292992.g001 | | Larvae | 1st Instar | Other (add to comments) | Other (add to comments) | >90% toxicity at 24.1µg/cm2. Cry1Ac protein solubilised from crystal preparation from Bt HD73 and trypsin activated, assayed on cob corn discs | Colin Berry | 2024-06-13 |
| 1404 | | 129795 | Cry1Ac | No | Not applicable | Lepidoptera | Diatraea indigenella | Yes | 2026897 | | µg/cm2 | | >90% | 10.1371/journal.pone.0292992.g001 | | Larvae | 1st Instar | Other (add to comments) | Other (add to comments) | >90% toxicity at 24.1µg/cm2. Cry1Ac protein solubilised from crystal preparation from Bt HD73 and trypsin activated, assayed on cob corn discs | Colin Berry | 2024-06-13 |
| 1405 | | 129794 | Cry1Ac | No | Not applicable | Lepidoptera | Diatraea busckella | Yes | 236796 | | µg/cm2 | | >90% | 10.1371/journal.pone.0292992.g001 | | Larvae | 1st Instar | Other (add to comments) | Other (add to comments) | >90% toxicity at 24.1µg/cm2. Cry1Ac protein solubilised from crystal preparation from Bt HD73 and trypsin activated, assayed on cob corn discs | Colin Berry | 2024-06-13 |
| 1406 | | 129792 | Cry1Ac | No | Not applicable | Lepidoptera | Conopomorpha cramerella | Yes | 538958 | | | | 60% mortality | 10.1002/ps.927 | | | 3rd-4th instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-24 |
| 1407 | | 46650 | Cry1Ac | No | Not applicable | Lepidoptera | Conogethes punctiferalis | Yes | 1133088 | 2.82 | ng/cm2 | | | 10.1016/j.jip.2020.107507 | | Larvae | 1st Instar | Purified protein | Surface contamination | | Colin Berry | 2024-01-30 |
| 1408 | | 129791 | Cry1Ac | No | Not applicable | Lepidoptera | Cnaphalocrocis medinalis | Yes | 437488 | 0.673 | µg/ml | | | 10.3390/toxins15040275 | | Larvae | 2nd Instar | Purified protein | Leaf-dip | | Colin Berry | 2024-06-13 |
| 1409 | | 138212 | Cry1Ac | No | Not applicable | Lepidoptera | Scirpophaga incertulas | Yes | 72366 | 0.33 | ng/ml | | | 10.1128/aem.63.4.1453-1459.1997 | | | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1410 | | 129790 | Cry1Ac | No | Not applicable | Lepidoptera | Cnaphalocrocis medinalis | Yes | 437488 | 0.809 | µg/ml | | | 10.1111/imb.12741 | | Larvae | 2nd Instar | Purified protein | Leaf-dip | | Colin Berry | 2024-06-13 |
| 1411 | | 138216 | Cry1Ac | No | Not applicable | Lepidoptera | Chilo suppressalis | Yes | 168631 | 237.81 | ng/ml | | | 10.1128/aem.63.4.1453-1459.1997 | | | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1412 | | 138222 | Cry1Ac | No | Not applicable | Lepidoptera | Spodoptera frugiperda | No | 7108 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/aem.65.2.457-464.1999 | | Larvae | 1st instar | Purified protein | Surface contamination | LC50>2000ng/cm2 | Colin Berry | 2025-09-04 |
| 1413 | | 138226 | Cry1Ac | No | Not applicable | Lepidoptera | Spodoptera exigua | No | 7107 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/aem.65.2.457-464.1999 | | Larvae | 1st instar | Purified protein | Surface contamination | LC50>2000ng/cm2 | Colin Berry | 2025-09-04 |
| 1414 | | 129789 | Cry1Ac | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | 119 | ng/cm2 | | | 10.1128/AEM.00326-17 | | larvae | 1st instar | Purified protein | | | Colin Berry | 2024-06-13 |
| 1415 | | 129788 | Cry1Ac | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | 4.98 | ng/cm2 | | | 10.1093/jee/toaa236 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-19 |
| 1416 | | 129787 | Cry1Ac | No | Not applicable | Lepidoptera | Chrysodeixis includens | Yes | 689277 | 27.53 | ng/cm2 | | | 10.1038/s41598-021-00770-0 | | Larvae | 1st instar | Other (add to comments) | Diet incorporation | Pseudomonas expressing toxin used in assays | Colin Berry | 2024-06-13 |
| 1417 | | 129786 | Cry1Ac | No | Not applicable | Lepidoptera | Choristoneura rosaceana | Yes | 27543 | 2.4 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1418 | | 129785 | Cry1Ac | No | Not applicable | Lepidoptera | Choristoneura pinus | Yes | 27542 | 37.4 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1419 | | 129784 | Cry1Ac | No | Not applicable | Lepidoptera | Choristoneura occidentalis | Yes | 27541 | 57.6 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1420 | | 129783 | Cry1Ac | No | Not applicable | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | 0.39 | ng total protein | | | 10.1128/aem.57.6.1650-1655.1991 | | Cultured cells | | Purified protein | Addition to cell culture | | Colin Berry | 2024-07-19 |
| 1421 | | 129782 | Cry1Ac | No | Not applicable | Lepidoptera | Choristoneura fumiferana | Yes | 7141 | 27.9 | ng/larva | | | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1422 | | 129780 | Cry1Ac | No | Not applicable | Lepidoptera | Argyrotaenia citrana | Yes | 96881 | 32.3 | ng/cm2 | | | Journal of Agricultural Entomology, 1998, Vol. 15, No. 2, 93-103 | | larvae | 1st instar | Other | Surface contamination | Formulated lyophilised recombinant material assayed | Colin Berry | 2024-09-02 |
| 1423 | | 129779 | Cry1Ac | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | 2 | ng/cm2 | | | 10.1128/AEM.00326-17 | | larvae | 1st instar | Purified protein | | | Colin Berry | 2024-06-13 |
| 1424 | | 129778 | Cry1Ac | No | Not applicable | Lepidoptera | Anticarsia gemmatalis | Yes | 129554 | 0.15 | ng/cm2 | | | 10.1093/jee/toaa236 | | Larvae | 1st instar | Purified protein | Surface contamination | | Colin Berry | 2024-07-19 |
| 1425 | | 129777 | Cry1Ac | No | Not applicable | Lepidoptera | Actebia fennica | No | 989868 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1128/aem.57.6.1650-1655.1991 | | Larvae | Not specified | Purified protein | Other (add to comments) | Administered by force feeding. Activity expressed as FFD50 | Colin Berry | 2024-07-19 |
| 1426 | | 138559 | Cry1Ac | No | Not applicable | Coleoptera | Rhynchophorus ferrugineus | No | 354439 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.3390/toxins17020084 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1427 | | 129628 | Cry1Ac | No | Not applicable | Hemiptera | Orius albidipennis | No | 1005351 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1093/ee/36.5.1246 | | Nymphs | | Other | Other (add to comments) | Nyphs fed on Helicoverpa armigera prefed with toxin (confirmed toxic) or with water containing toxin | Colin Berry | 2024-07-29 |
| 1428 | | 129627 | Cry1Ac | No | Not applicable | Hemiptera | Diaphorina citri | Yes | 121845 | | | | 44% mortality | 10.1111/1744-7917.12654 | | Nymph | 3rd Instar | Spore crystal mix | | 44% at 5 days | Colin Berry | 2023-12-18 |
| 1429 | | 129626 | Cry1Ac | No | Not applicable | Hemiptera | Diaphorina citri | No | 121845 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/j.jip.2024.108122 | | Adults | | Purified protein | Membrane feeding | Mortality not significantly different for trypsin activated protein at 500µg/ml compared to buffer control | Colin Berry | 2024-06-13 |
| 1430 | | 129612 | Cry1Ac | No | Not applicable | Entomobryomorpha | Folsomia candida | No | 158441 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1371/journal.pone.0232747 | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-07-25 |
| 1431 | | 129611 | Cry1Ac | No | Not applicable | Entomobryomorpha | Folsomia candida | No | 158441 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1093/jee/90.1.113 | | | | Transgenic plant | Transgenic plant | | Colin Berry | 2024-08-07 |
| 1432 | | 129610 | Cry1Ac | No | Not applicable | Entomobryomorpha | Folsomia candida | No | 158441 | N/A, not toxic | N/A, not toxic | | N/A, not toxic | 10.1016/S0031-4056(24)00312-3 | | | | Purified protein | Diet incorporation | | Colin Berry | 2024-07-25 |
| 1433 | | 129556 | Cry1Ac | No | Not applicable | Diptera | Chironomus dilutus | Yes | 109233 | 155 | ng/g | | | 10.1021/jf403472j | | Larvae | 3rd instar | Other | Other (add to comments) | Crude protein extracted from transgenic cotton seeds added to sediment and assayed. Mortality <50% at highest dose of 157ng/g | Colin Berry | 2024-07-29 |
| 1434 | | 138548 | Cry1Ac | No | Not applicable | Coleoptera | Anthonomus grandis | Yes | 7044 | 317 | µg/g | | | 10.3390/toxins15010055 | | Larvae | 1st instar | Purified protein | Diet incorporation | | Colin Berry | 2025-09-04 |
| 1435 | | 49653 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 37.8 | ng/ml | | | 10.1002/arch.21845 | | Larvae | 4th Instar | Not specified | Surface contamination | Assay method: toxin were diluted and then overlaid on the diet surface; | Jorge Zimmermann | 2023-04-21 |
| 1436 | | 48929 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.001 | µg/ml | | | 10.1002/ps.313 | | Larvae | 3rd Instar | Purified crystals | Leaf-dip | Use of resistant insects, different generations and cross-resistance is also described in the work | Jorge Zimmermann | 2023-04-21 |
| 1437 | | 49649 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | | 10.1002/ps.6922 | | Larvae | 3rd Instar | Spore crystal mix | Leaf-dip | | Jorge Zimmermann | 2023-04-21 |
| 1438 | | 49656 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 5.96 | ng/cm2 | | | 10.1016/j.ijbiomac.2020.08.175 | | Larvae | 2nd Instar | Purified protein | Not specified | | Jorge Zimmermann | 2023-04-21 |
| 1439 | | 49652 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | | | | Approx 96% at 6µg/ml | 10.1016/j.ijbiomac.2021.08.193 | | Larvae | 2nd Instar | Diluted whole cell culture | Leaf-dip | | Jorge Zimmermann | 2023-04-21 |
| 1440 | | 48928 | Cry1Ac | No | Not applicable | Lepidoptera | Plutella xylostella | Yes | 51655 | 0.38 | µg/g | | | 1 |
